Recombinant Human TMPO protein(411-480 aa), C-His-tagged

• Cat.No.: TMPO-2759H
• Product Overview: Recombinant Human TMPO protein(P42166)(411-480 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 411-480 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: RIDQSKFQETEFLSPPRKVPRLSEKSVEERDSGSFVAFQNIPGSELMSSFAKTVVSHSLTTLGLEVAKQS

Gene Information

• Gene Name: TMPO thymopoietin [ Homo sapiens ]
• Official Symbol: TMPO
• Synonyms: TMPO; thymopoietin; LAP2; LEM domain containing 4; LEMD4; TP; TP alpha; TP beta/gamma; lamina-associated polypeptide 2; thymopoietin-related peptide isoform alpha; thymopoietin-related peptide isoforms beta/gamma; CMD1T; PRO0868; MGC61508
• Gene ID: 7112
• mRNA Refseq: NM_001032283
• Protein Refseq: NP_001027454
• MIM: 188380
• UniProt ID: P42166