Recombinant Human TMPO protein(411-480 aa), C-His-tagged
Cat.No. : | TMPO-2759H |
Product Overview : | Recombinant Human TMPO protein(P42166)(411-480 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 411-480 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RIDQSKFQETEFLSPPRKVPRLSEKSVEERDSGSFVAFQNIPGSELMSSFAKTVVSHSLTTLGLEVAKQS |
Gene Name | TMPO thymopoietin [ Homo sapiens ] |
Official Symbol | TMPO |
Synonyms | TMPO; thymopoietin; LAP2; LEM domain containing 4; LEMD4; TP; TP alpha; TP beta/gamma; lamina-associated polypeptide 2; thymopoietin-related peptide isoform alpha; thymopoietin-related peptide isoforms beta/gamma; CMD1T; PRO0868; MGC61508; |
Gene ID | 7112 |
mRNA Refseq | NM_001032283 |
Protein Refseq | NP_001027454 |
MIM | 188380 |
UniProt ID | P42166 |
◆ Recombinant Proteins | ||
RFL19639RF | Recombinant Full Length Rat Lamina-Associated Polypeptide 2, Isoform Beta(Tmpo) Protein, His-Tagged | +Inquiry |
TMPO-1382C | Recombinant Chicken TMPO | +Inquiry |
TMPO-4667R | Recombinant Rhesus Macaque TMPO Protein, His (Fc)-Avi-tagged | +Inquiry |
TMPO-5025H | Recombinant Human TMPO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMPO-185H | Recombinant Human TMPO Protein, HIS-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPO-912HCL | Recombinant Human TMPO 293 Cell Lysate | +Inquiry |
TMPO-913HCL | Recombinant Human TMPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMPO Products
Required fields are marked with *
My Review for All TMPO Products
Required fields are marked with *
0
Inquiry Basket