Recombinant Human TMUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMUB1-2444H
Product Overview : TMUB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129516) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. Involved in positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface. Acts as negative regulator of hepatocyte growth during regeneration.
Molecular Mass : 26.1 kDa
AA Sequence : MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMUB1 transmembrane and ubiquitin-like domain containing 1 [ Homo sapiens (human) ]
Official Symbol TMUB1
Synonyms TMUB1; transmembrane and ubiquitin-like domain containing 1; C7orf21, chromosome 7 open reading frame 21; transmembrane and ubiquitin-like domain-containing protein 1; SB144; ubiquitin-like protein DULP; ubiquitin-like protein SB144; hepatocyte odd protein shuttling protein; C7orf21; MGC5442;
Gene ID 83590
mRNA Refseq NM_001136044
Protein Refseq NP_001129516
MIM 614792
UniProt ID Q9BVT8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMUB1 Products

Required fields are marked with *

My Review for All TMUB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon