Recombinant Human TTC9C Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TTC9C-1417H |
| Product Overview : | TTC9C MS Standard C13 and N15-labeled recombinant protein (NP_776171) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TTC9C (Tetratricopeptide Repeat Domain 9C) is a Protein Coding gene. An important paralog of this gene is TTC9. |
| Molecular Mass : | 20 kDa |
| AA Sequence : | MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TTC9C tetratricopeptide repeat domain 9C [ Homo sapiens (human) ] |
| Official Symbol | TTC9C |
| Synonyms | TTC9C; tetratricopeptide repeat domain 9C; tetratricopeptide repeat protein 9C; MGC29649; TPR repeat protein 9C; |
| Gene ID | 283237 |
| mRNA Refseq | NM_173810 |
| Protein Refseq | NP_776171 |
| UniProt ID | Q8N5M4 |
| ◆ Recombinant Proteins | ||
| TTC9C-6345R | Recombinant Rat TTC9C Protein | +Inquiry |
| TTC9C-801C | Recombinant Cynomolgus Monkey TTC9C Protein, His (Fc)-Avi-tagged | +Inquiry |
| TTC9C-10603Z | Recombinant Zebrafish TTC9C | +Inquiry |
| TTC9C-1058C | Recombinant Cynomolgus TTC9C Protein, His-tagged | +Inquiry |
| TTC9C-4833R | Recombinant Rhesus Macaque TTC9C Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TTC9C-672HCL | Recombinant Human TTC9C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTC9C Products
Required fields are marked with *
My Review for All TTC9C Products
Required fields are marked with *



