Recombinant Human TTC9C Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TTC9C-1417H
Product Overview : TTC9C MS Standard C13 and N15-labeled recombinant protein (NP_776171) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TTC9C (Tetratricopeptide Repeat Domain 9C) is a Protein Coding gene. An important paralog of this gene is TTC9.
Molecular Mass : 20 kDa
AA Sequence : MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TTC9C tetratricopeptide repeat domain 9C [ Homo sapiens (human) ]
Official Symbol TTC9C
Synonyms TTC9C; tetratricopeptide repeat domain 9C; tetratricopeptide repeat protein 9C; MGC29649; TPR repeat protein 9C;
Gene ID 283237
mRNA Refseq NM_173810
Protein Refseq NP_776171
UniProt ID Q8N5M4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TTC9C Products

Required fields are marked with *

My Review for All TTC9C Products

Required fields are marked with *

0
cart-icon
0
compare icon