Recombinant Human UFC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UFC1-4367H |
Product Overview : | UFC1 MS Standard C13 and N15-labeled recombinant protein (NP_057490) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1 (UFM1). |
Molecular Mass : | 19.3 kDa |
AA Sequence : | MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITCPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UFC1 ubiquitin-fold modifier conjugating enzyme 1 [ Homo sapiens (human) ] |
Official Symbol | UFC1 |
Synonyms | UFC1; ubiquitin-fold modifier conjugating enzyme 1; ubiquitin-fold modifier-conjugating enzyme 1; HSPC155; Ufm1-conjugating enzyme 1; |
Gene ID | 51506 |
mRNA Refseq | NM_016406 |
Protein Refseq | NP_057490 |
MIM | 610554 |
UniProt ID | Q9Y3C8 |
◆ Recombinant Proteins | ||
UFC1-9875M | Recombinant Mouse UFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UFC1-6080R | Recombinant Rat UFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UFC1-17793M | Recombinant Mouse UFC1 Protein | +Inquiry |
Ufc1-6824M | Recombinant Mouse Ufc1 Protein, Myc/DDK-tagged | +Inquiry |
UFC1-4367H | Recombinant Human UFC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
UFC1-522HCL | Recombinant Human UFC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UFC1 Products
Required fields are marked with *
My Review for All UFC1 Products
Required fields are marked with *