Recombinant Human UFC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UFC1-4367H
Product Overview : UFC1 MS Standard C13 and N15-labeled recombinant protein (NP_057490) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1 (UFM1).
Molecular Mass : 19.3 kDa
AA Sequence : MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITCPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UFC1 ubiquitin-fold modifier conjugating enzyme 1 [ Homo sapiens (human) ]
Official Symbol UFC1
Synonyms UFC1; ubiquitin-fold modifier conjugating enzyme 1; ubiquitin-fold modifier-conjugating enzyme 1; HSPC155; Ufm1-conjugating enzyme 1;
Gene ID 51506
mRNA Refseq NM_016406
Protein Refseq NP_057490
MIM 610554
UniProt ID Q9Y3C8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UFC1 Products

Required fields are marked with *

My Review for All UFC1 Products

Required fields are marked with *

0
cart-icon