Recombinant Human WNT3A protein, GST-tagged
Cat.No. : | WNT3A-4930H |
Product Overview : | Recombinant Human WNT3A(1 a.a. - 385 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-385 a.a. |
Description : | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 69.3 kDa |
AA Sequence : | MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQ ECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGW KWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFR AIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCKNPGSRAGNSAHQPPHPQPPVRFH PPLRRAGKVP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | WNT3A wingless-type MMTV integration site family, member 3A [ Homo sapiens ] |
Official Symbol | WNT3A |
Synonyms | WNT3A; wingless-type MMTV integration site family, member 3A; protein Wnt-3a; MGC119418; MGC119419; MGC119420; |
Gene ID | 89780 |
mRNA Refseq | NM_033131 |
Protein Refseq | NP_149122 |
MIM | 606359 |
UniProt ID | P56704 |
Chromosome Location | 1q42 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; |
Function | extracellular matrix structural constituent; frizzled-2 binding; protein binding; protein domain specific binding; receptor agonist activity; transcription coactivator activity; |
◆ Recombinant Proteins | ||
WNT3A-185H | Recombinant Human WNT3A protein | +Inquiry |
Wnt3a-585M | Recombinant Mouse Wnt3a Protein, His-tagged | +Inquiry |
WNT3A-265H | Recombinant Human WNT3A, StrepII-tagged | +Inquiry |
WNT3A-1700H | Recombinant Human WNT3A | +Inquiry |
WNT3A-457H | Recombinant Human WNT3A protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT3A-295HCL | Recombinant Human WNT3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT3A Products
Required fields are marked with *
My Review for All WNT3A Products
Required fields are marked with *
0
Inquiry Basket