Recombinant Human WNT7B protein, GST-tagged

Cat.No. : WNT7B-16H
Product Overview : Recombinant Human WNT7B(241 a.a. - 349 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 241-349 a.a.
Description : This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.73 kDa
AA Sequence : VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNT HQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name WNT7B wingless-type MMTV integration site family, member 7B [ Homo sapiens ]
Official Symbol WNT7B
Synonyms WNT7B; wingless-type MMTV integration site family, member 7B; protein Wnt-7b;
Gene ID 7477
mRNA Refseq NM_058238
Protein Refseq NP_478679
MIM 601967
UniProt ID P56706
Chromosome Location 22q13
Pathway Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function extracellular matrix structural constituent; frizzled binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WNT7B Products

Required fields are marked with *

My Review for All WNT7B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon