Recombinant Human WNT7B protein, GST-tagged
Cat.No. : | WNT7B-16H |
Product Overview : | Recombinant Human WNT7B(241 a.a. - 349 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 241-349 a.a. |
Description : | This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNT HQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | WNT7B wingless-type MMTV integration site family, member 7B [ Homo sapiens ] |
Official Symbol | WNT7B |
Synonyms | WNT7B; wingless-type MMTV integration site family, member 7B; protein Wnt-7b; |
Gene ID | 7477 |
mRNA Refseq | NM_058238 |
Protein Refseq | NP_478679 |
MIM | 601967 |
UniProt ID | P56706 |
Chromosome Location | 22q13 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | extracellular matrix structural constituent; frizzled binding; receptor binding; |
◆ Recombinant Proteins | ||
WNT7B-4053C | Recombinant Chicken WNT7B | +Inquiry |
WNT7B-3291C | Recombinant Chicken WNT7B | +Inquiry |
WNT7B-588H | Recombinant Human WNT7B Protein, His&SUMO-tagged | +Inquiry |
WNT7B-2786H | Recombinant Human WNT7B Protein (25-349 aa), His-Myc-tagged | +Inquiry |
WNT7B-16H | Recombinant Human WNT7B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT7B-288HCL | Recombinant Human WNT7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT7B Products
Required fields are marked with *
My Review for All WNT7B Products
Required fields are marked with *
0
Inquiry Basket