Recombinant Human ZNF706 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZNF706-2439H |
Product Overview : | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_057180) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Transcription repressor involved in the exit of embryonic stem cells (ESCs) from self-renewal. Acts by repressing expression of KLF4. |
Molecular Mass : | 8.5 kDa |
AA Sequence : | MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZNF706 zinc finger protein 706 [ Homo sapiens (human) ] |
Official Symbol | ZNF706 |
Synonyms | ZNF706; zinc finger protein 706; HSPC038; PNAS-106; PNAS-113; |
Gene ID | 51123 |
mRNA Refseq | NM_016096 |
Protein Refseq | NP_057180 |
UniProt ID | Q9Y5V0 |
◆ Recombinant Proteins | ||
ZNF706-3692C | Recombinant Chicken ZNF706 | +Inquiry |
ZNF706-2439H | Recombinant Human ZNF706 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Zfp706-7097M | Recombinant Mouse Zfp706 Protein, Myc/DDK-tagged | +Inquiry |
ZNF706-7843Z | Recombinant Zebrafish ZNF706 | +Inquiry |
ZNF706-7842Z | Recombinant Zebrafish ZNF706 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF706-20HCL | Recombinant Human ZNF706 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF706 Products
Required fields are marked with *
My Review for All ZNF706 Products
Required fields are marked with *