Recombinant Human ZNRD1 protein, GST-tagged

Cat.No. : ZNRD1-3879H
Product Overview : Recombinant Human ZNRD1 protein(1-126 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability November 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-126 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name ZNRD1 zinc ribbon domain containing 1 [ Homo sapiens ]
Official Symbol ZNRD1
Synonyms ZNRD1; zinc ribbon domain containing 1; zinc ribbon domain containing, 1; DNA-directed RNA polymerase I subunit RPA12; HTEX 6; hZR14; RPA12; tctex 6; zinc ribbon domain-containing protein 1; transcription-associated zinc ribbon protein; RNA polymerase I small specific subunit Rpa12; TEX6; Rpa12; HTEX-6; tctex-6; MGC13376;
Gene ID 30834
mRNA Refseq NM_014596
Protein Refseq NP_055411
MIM 607525
UniProt ID Q9P1U0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNRD1 Products

Required fields are marked with *

My Review for All ZNRD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon