Recombinant Human ZNRD1 protein, GST-tagged

• Cat.No.: ZNRD1-3879H
• Product Overview: Recombinant Human ZNRD1 protein(1-126 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-126 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: ZNRD1 zinc ribbon domain containing 1 [ Homo sapiens ]
• Official Symbol: ZNRD1
• Synonyms: ZNRD1; zinc ribbon domain containing 1; zinc ribbon domain containing, 1; DNA-directed RNA polymerase I subunit RPA12; HTEX 6; hZR14; RPA12; tctex 6; zinc ribbon domain-containing protein 1; transcription-associated zinc ribbon protein; RNA polymerase I small specific subunit Rpa12; TEX6; Rpa12; HTEX-6; tctex-6; MGC13376
• Gene ID: 30834
• mRNA Refseq: NM_014596
• Protein Refseq: NP_055411
• MIM: 607525
• UniProt ID: Q9P1U0