Recombinant Mouse ATP5G1 Protein, His-tagged

Cat.No. : ATP5G1-2135M
Product Overview : Recombinant Mouse ATP5G1 Protein(NP_001154891.1), fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Form : Lyophilized from 20 mM Tris-HCl, 0.15M NaCl, 0.05%Brij78, 6% Trehalose, pH 8.0.
The volume before lyophilization is 20μl/vial
Molecular Mass : The protein has a calculated MW of 18 kDa.
AA Sequence : DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Purity : ≥85%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP5G1 Products

Required fields are marked with *

My Review for All ATP5G1 Products

Required fields are marked with *

0
cart-icon