Recombinant Mouse CES1C Protein, His-tagged
Cat.No. : | CES1C-1163M |
Product Overview : | Recombinant Mouse CES1C Protein (19-550aa) was expressed in yeast with N-terminal 6xHis-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-550 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 60.6 kDa |
AA Sequence : | HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Ces1c carboxylesterase 1C [ Mus musculus ] |
Official Symbol | CES1C |
Synonyms | CES1C; carboxylesterase 1C |
Gene ID | 13884 |
mRNA Refseq | NM_007954.4 |
Protein Refseq | NP_031980.2 |
UniProt ID | P23953 |
◆ Recombinant Proteins | ||
CES1C-3323M | Recombinant Mouse CES1C Protein | +Inquiry |
CES1C-1007R | Recombinant Rat CES1C Protein, His (Fc)-Avi-tagged | +Inquiry |
CES1C-919M | Recombinant Mouse CES1C Protein (19-550 aa), GST-tagged | +Inquiry |
Ces1c-6343M | Recombinant Mouse Ces1c protein, His&Myc-tagged | +Inquiry |
CES1C-1349R | Recombinant Rat CES1C Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CES1C Products
Required fields are marked with *
My Review for All CES1C Products
Required fields are marked with *
0
Inquiry Basket