Recombinant Mouse CES1C Protein, His-tagged
| Cat.No. : | CES1C-1163M |
| Product Overview : | Recombinant Mouse CES1C Protein (19-550aa) was expressed in yeast with N-terminal 6xHis-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 19-550 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 60.6 kDa |
| AA Sequence : | HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Ces1c carboxylesterase 1C [ Mus musculus ] |
| Official Symbol | CES1C |
| Synonyms | CES1C; carboxylesterase 1C |
| Gene ID | 13884 |
| mRNA Refseq | NM_007954.4 |
| Protein Refseq | NP_031980.2 |
| UniProt ID | P23953 |
| ◆ Recombinant Proteins | ||
| CES1C-3323M | Recombinant Mouse CES1C Protein | +Inquiry |
| CES1C-1599M | Recombinant Mouse CES1C Protein, His (Fc)-Avi-tagged | +Inquiry |
| CES1C-1163M | Recombinant Mouse CES1C Protein, His-tagged | +Inquiry |
| Ces1c-4021M | Recombinant Mouse Ces1c protein | +Inquiry |
| Ces1c-6343M | Recombinant Mouse Ces1c protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CES1C Products
Required fields are marked with *
My Review for All CES1C Products
Required fields are marked with *
