Recombinant Mouse GJA1 protein, His-tagged
Cat.No. : | GJA1-893M |
Product Overview : | Recombinant Mouse GJA1 protein is produced by E. coli expression system. This protein is fused with a His tag at the N-terminal. |
Availability | October 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | Ser180-Ile382 |
Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
Molecular Mass : | 26 kDa |
AA Sequence : | SLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 97% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | Gja1 gap junction protein, alpha 1 [ Mus musculus ] |
Official Symbol | GJA1 |
Synonyms | GJA1; gap junction protein, alpha 1; connexin 43; connexin-43; alpha 1 connexin; Cx43; Npm1; Cnx43; Gja-1; AU042049; AW546267; Cx43alpha1; connexin43; |
Gene ID | 14609 |
mRNA Refseq | NM_010288 |
Protein Refseq | NP_034418 |
◆ Recombinant Proteins | ||
RFL11994RF | Recombinant Full Length Rat Gap Junction Alpha-1 Protein(Gja1) Protein, His-Tagged | +Inquiry |
GJA1-3569M | Recombinant Mouse GJA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gja1-352R | Recombinant Rat Gja1 Protein, His-tagged | +Inquiry |
GJA1-1312H | Recombinant Human GJA1 protein, His-tagged | +Inquiry |
Gja1-951M | Recombinant Mouse Gja1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJA1-5923HCL | Recombinant Human GJA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJA1 Products
Required fields are marked with *
My Review for All GJA1 Products
Required fields are marked with *