Recombinant Mouse Gstm1 Protein
| Cat.No. : | Gstm1-7220M |
| Product Overview : | Recombinant mouse GSTM1 protein without tag was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Protein Length : | 1-218 |
| Description : | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. |
| Form : | Liquid |
| Molecular Mass : | 25.9 kDa |
| AA Sequence : | MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK |
| Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
| Purity : | > 95 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by Bradford assay) |
| Storage Buffer : | PBS (pH 7.4) containing 5 mM glutathione |
| Gene Name | Gstm1 glutathione S-transferase, mu 1 [ Mus musculus (house mouse) ] |
| Official Symbol | Gstm1 |
| Synonyms | Gstm1; glutathione S-transferase, mu 1; Gstb; Gstb-; Gstb1; Gstb-1; glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; glutathione S-transferase GT8.7; pmGT10; EC 2.5.1.18 |
| Gene ID | 14862 |
| mRNA Refseq | NM_010358 |
| Protein Refseq | NP_034488 |
| UniProt ID | P10649 |
| ◆ Recombinant Proteins | ||
| GSTM1-23H | Active Recombinant Human GSTM1 Protein | +Inquiry |
| GSTM1-7330M | Recombinant Mouse GSTM1 Protein | +Inquiry |
| GSTM1-2451H | Recombinant Human GSTM1 Protein (Met1-Lys181), N-His tagged | +Inquiry |
| Gstm1-567R | Recombinant Rat Gstm1 protein, His-tagged | +Inquiry |
| Gstm1-643M | Recombinant Mouse Gstm1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTM1-5713HCL | Recombinant Human GSTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gstm1 Products
Required fields are marked with *
My Review for All Gstm1 Products
Required fields are marked with *
