Recombinant Mouse Gstm1 Protein, His-tagged
Cat.No. : | Gstm1-7221M |
Product Overview : | Recombinant GSTM1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-218 |
Description : | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. |
Form : | Liquid |
Molecular Mass : | 28.1 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 10 % glycerol |
Gene Name | Gstm1 glutathione S-transferase, mu 1 [ Mus musculus (house mouse) ] |
Official Symbol | Gstm1 |
Synonyms | Gstm1; glutathione S-transferase, mu 1; Gstb; Gstb-; Gstb1; Gstb-1; glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; glutathione S-transferase GT8.7; pmGT10; EC 2.5.1.18 |
Gene ID | 14862 |
mRNA Refseq | NM_010358 |
Protein Refseq | NP_034488 |
UniProt ID | P10649 |
◆ Recombinant Proteins | ||
Gstm1-567R | Recombinant Rat Gstm1 protein, His-tagged | +Inquiry |
GSTM1-105H | Active Recombinant Human GSTM1 Protein | +Inquiry |
GSTM1-2732R | Recombinant Rat GSTM1 Protein | +Inquiry |
GSTM1-7496H | Recombinant Human GSTM1 protein, His-tagged | +Inquiry |
GSTM1-3360HF | Recombinant Full Length Human GSTM1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTM1-5713HCL | Recombinant Human GSTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gstm1 Products
Required fields are marked with *
My Review for All Gstm1 Products
Required fields are marked with *