Recombinant Mouse Gstm1 Protein, His-tagged

Cat.No. : Gstm1-7221M
Product Overview : Recombinant GSTM1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-218
Description : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Form : Liquid
Molecular Mass : 28.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 10 % glycerol
Gene Name Gstm1 glutathione S-transferase, mu 1 [ Mus musculus (house mouse) ]
Official Symbol Gstm1
Synonyms Gstm1; glutathione S-transferase, mu 1; Gstb; Gstb-; Gstb1; Gstb-1; glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; glutathione S-transferase GT8.7; pmGT10; EC 2.5.1.18
Gene ID 14862
mRNA Refseq NM_010358
Protein Refseq NP_034488
UniProt ID P10649

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gstm1 Products

Required fields are marked with *

My Review for All Gstm1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon