Recombinant Mouse NPY2R Protein (1-51 aa), His-SUMO-Myc-tagged

• Cat.No.: NPY2R-2569M
• Product Overview: Recombinant Mouse NPY2R Protein (1-51 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cardiovascular. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 1-51 aa
• Description: Receptor for neuropeptide Y and peptide YY.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.5 kDa
• AA Sequence: MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Npy2r neuropeptide Y receptor Y2 [ Mus musculus ]
• Official Symbol: NPY2R
• Synonyms: NPY2R; neuropeptide Y receptor Y2; Y2 receptor; NPY-Y2 receptor; NPY2-R; MGC124241; MGC124242; MGC124244
• Gene ID: 18167
• mRNA Refseq: NM_001205099
• Protein Refseq: NP_001192028
• UniProt ID: P97295