Recombinant Mouse NPY2R Protein (1-51 aa), His-SUMO-Myc-tagged

Cat.No. : NPY2R-2569M
Product Overview : Recombinant Mouse NPY2R Protein (1-51 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cardiovascular. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-51 aa
Description : Receptor for neuropeptide Y and peptide YY.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 25.5 kDa
AA Sequence : MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Npy2r neuropeptide Y receptor Y2 [ Mus musculus ]
Official Symbol NPY2R
Synonyms NPY2R; neuropeptide Y receptor Y2; Y2 receptor; NPY-Y2 receptor; NPY2-R; MGC124241; MGC124242; MGC124244;
Gene ID 18167
mRNA Refseq NM_001205099
Protein Refseq NP_001192028
UniProt ID P97295

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPY2R Products

Required fields are marked with *

My Review for All NPY2R Products

Required fields are marked with *

0

Inquiry Basket

cartIcon