Recombinant Mouse NPY2R Protein (1-51 aa), His-SUMO-Myc-tagged
Cat.No. : | NPY2R-2569M |
Product Overview : | Recombinant Mouse NPY2R Protein (1-51 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-51 aa |
Description : | Receptor for neuropeptide Y and peptide YY. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.5 kDa |
AA Sequence : | MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Npy2r neuropeptide Y receptor Y2 [ Mus musculus ] |
Official Symbol | NPY2R |
Synonyms | NPY2R; neuropeptide Y receptor Y2; Y2 receptor; NPY-Y2 receptor; NPY2-R; MGC124241; MGC124242; MGC124244; |
Gene ID | 18167 |
mRNA Refseq | NM_001205099 |
Protein Refseq | NP_001192028 |
UniProt ID | P97295 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPY2R Products
Required fields are marked with *
My Review for All NPY2R Products
Required fields are marked with *