Recombinant Mouse Stc2 Protein, 25-296aa, C-His tagged
Cat.No. : | STC2-16118M |
Product Overview : | Recombinant Mouse Stc2 Protein (25-296aa) with C-His tag was expressed in hek293. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 25-296aa |
Description : | Predicted to enable enzyme binding activity; heme binding activity; and protein homodimerization activity. Acts upstream of or within several processes, including cellular calcium ion homeostasis; endoplasmic reticulum unfolded protein response; and regulation of store-operated calcium entry. Located in Golgi apparatus and endoplasmic reticulum. Is expressed in several structures, including embryo mesenchyme; genitourinary system; gut; olfactory epithelium; and vertebral axis musculature. Orthologous to human STC2 (stanniocalcin 2). |
Form : | Liquid |
Molecular Mass : | Theoretical molecular weight: ~ 30 kDa including His tag. |
AA Sequence : | TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRRHHHHHH |
Purity : | > 90% as determined by SDS-PAGE |
Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.72 mg/mL |
Storage Buffer : | PBS, pH 7.4 |
Publications : |
Histidine-Rich Glycoprotein and Stanniocalcin-2 High Affinity Interactions with Inflammatory Cells (2022)
Quartz Crystal Microbalance Measurement of Histidine-Rich Glycoprotein and Stanniocalcin-2 Binding to Each Other and to Inflammatory Cells (2021)
Leukocyte differentiation by histidine-rich glycoprotein/stanniocalcin-2 complex regulates murine glioma growth through modulation of antitumor immunity (2018)
|
Gene Name | Stc2 stanniocalcin 2 [ Mus musculus (house mouse) ] |
Official Symbol | Stc2 |
Synonyms | Stc2; stanniocalcin 2; Stc-2; Stc2l; mustc2; stanniocalcin-2 |
Gene ID | 20856 |
mRNA Refseq | NM_011491 |
Protein Refseq | NP_035621 |
UniProt ID | O88452 |
◆ Recombinant Proteins | ||
STC2-8603H | Recombinant Human STC2, Fc tagged | +Inquiry |
STC2-187H | Recombinant Human STC2, His tagged | +Inquiry |
STC2-8793M | Recombinant Mouse STC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Stc2-6176M | Recombinant Mouse Stc2 Protein, Myc/DDK-tagged | +Inquiry |
STC2-3028H | Recombinant Human STC2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STC2-849HCL | Recombinant Human STC2 cell lysate | +Inquiry |
Quartz Crystal Microbalance Measurement of Histidine-Rich Glycoprotein and Stanniocalcin-2 Binding to Each Other and to Inflammatory Cells
Journal: Cells Data: 2022/8/29
Authors: Tor Persson Skare, Hiroshi Kaito, Vivek P. Chavda
Article Snippet:The U937 cells were seeded at 10 4 cells per well in 8-well chamber slides (cat. no. 80826, ibidi, Fitchburg, WI, USA).The U937 cells were seeded at 10 4 cells per well in 8-well chamber slides (cat. no. 80826, ibidi, Fitchburg, WI, USA).. At the start of the experiment, cells were incubated with 10 nM vitD3, recombinant, in-house purified HRG (mouse) at 1 μg/mL (13.3 nM) [ ], and STC2 (mouse) (cat. no. STC2-16118 M, Creative BioMart, Shirley, NY, USA) or inactive HRG protein at equivalent molar concentrations together with sterile green E. coli bioparticles (cat. no. 4616, Essen Bioscience, Ann Arbor, MI, USA) at 33 μg/mL.. Following 20 h incubation at 37 °C in 5% CO 2 , cells were imaged at 10× with a Zeiss LSM 700 Microscope with AxioCam HRm and Zen Black software (Zeiss, Oberkochen, Germany).Following 20 h incubation at 37 °C in 5% CO 2 , cells were imaged at 10× with a Zeiss LSM 700 Microscope with AxioCam HRm and Zen Black software (Zeiss, Oberkochen, Germany).

Recombinant HRG binds

Affinity determination of HRG’s binding to

Binding of HRG and
Histidine-Rich Glycoprotein and Stanniocalcin-2 High Affinity Interactions with Inflammatory Cells
Data: 2022/1/17Authors: Lena Claesson-Welsh, Tor Persson Skare, Teodor Aastrup
Article Snippet:253 254 255 256 10 Purified proteins and phagocytosis assay 257 U937 cells were seeded at 104 cells per well in 8-well chamber slides (ibidi 80826).253 254 255 256 10 Purified proteins and phagocytosis assay 257 U937 cells were seeded at 104 cells per well in 8-well chamber slides (ibidi 80826).. At the start of the 258 experiment, cells were incubated with 10 nM vitD3, recombinant, in-house purified HRG (mouse) at 1 259 μg/ml (13.3 nM) 23, ,strong>STC2 (mouse) (cat no. STC2-16118M, Creative BioMart) or inactive HRG protein at 260 equivalent molar concentrations together with sterile green E. coli bioparticles (cat. no. 4616, Essen 261 Bioscience) at 33 μg/ml.. Following 20h incubation at 37°C in 5% CO2, cells were imaged at 10X with a 262 Zeiss LSM 700 Microscope with AxioCam HRm and Zen software (Zeiss).Following 20h incubation at 37°C in 5% CO2, cells were imaged at 10X with a 262 Zeiss LSM 700 Microscope with AxioCam HRm and Zen software (Zeiss).
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Stc2 Products
Required fields are marked with *
My Review for All Stc2 Products
Required fields are marked with *