Recombinant Mouse Stc2 Protein, 25-296aa, C-His tagged
Cat.No. : | STC2-16118M |
Product Overview : | Recombinant Mouse Stc2 Protein (25-296aa) with C-His tag was expressed in hek293. |
Availability | April 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 25-296aa |
Description : | Predicted to enable enzyme binding activity; heme binding activity; and protein homodimerization activity. Acts upstream of or within several processes, including cellular calcium ion homeostasis; endoplasmic reticulum unfolded protein response; and regulation of store-operated calcium entry. Located in Golgi apparatus and endoplasmic reticulum. Is expressed in several structures, including embryo mesenchyme; genitourinary system; gut; olfactory epithelium; and vertebral axis musculature. Orthologous to human STC2 (stanniocalcin 2). |
Form : | Liquid |
Molecular Mass : | Theoretical molecular weight: ~ 30 kDa including His tag. |
AA Sequence : | TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRRHHHHHH |
Purity : | > 90% as determined by SDS-PAGE |
Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.72 mg/mL |
Storage Buffer : | PBS, pH 7.4 |
Publications : |
Histidine-Rich Glycoprotein and Stanniocalcin-2 High Affinity Interactions with Inflammatory Cells (2022)
Quartz Crystal Microbalance Measurement of Histidine-Rich Glycoprotein and Stanniocalcin-2 Binding to Each Other and to Inflammatory Cells (2021)
Leukocyte differentiation by histidine-rich glycoprotein/stanniocalcin-2 complex regulates murine glioma growth through modulation of antitumor immunity (2018)
|
Gene Name | Stc2 stanniocalcin 2 [ Mus musculus (house mouse) ] |
Official Symbol | Stc2 |
Synonyms | Stc2; stanniocalcin 2; Stc-2; Stc2l; mustc2; stanniocalcin-2 |
Gene ID | 20856 |
mRNA Refseq | NM_011491 |
Protein Refseq | NP_035621 |
UniProt ID | O88452 |
◆ Recombinant Proteins | ||
STC2-142H | Recombinant Human Stanniocalcin 2, Flag-tagged | +Inquiry |
STC2-16118M | Recombinant Mouse Stc2 Protein, 25-296aa, C-His tagged | +Inquiry |
Stc2-6176M | Recombinant Mouse Stc2 Protein, Myc/DDK-tagged | +Inquiry |
STC2-8603H | Recombinant Human STC2, Fc tagged | +Inquiry |
STC2-7631H | Recombinant Human STC2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STC2-849HCL | Recombinant Human STC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Stc2 Products
Required fields are marked with *
My Review for All Stc2 Products
Required fields are marked with *
0
Inquiry Basket