Active Recombinant Full Length Human JUNB Protein, C-Flag-tagged
Cat.No. : | JUNB-294HFL |
Product Overview : | Recombinant Full Length Human JUNB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGA[CG]TCA-3'. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme substrate |
Molecular Mass : | 35.7 kDa |
AA Sequence : | MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFS GQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGGGGGVTEEQEGFADGFV KALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPT TTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRL AATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | JUNB JunB proto-oncogene, AP-1 transcription factor subunit [ Homo sapiens (human) ] |
Official Symbol | JUNB |
Synonyms | AP-1 |
Gene ID | 3726 |
mRNA Refseq | NM_002229.3 |
Protein Refseq | NP_002220.1 |
MIM | 165161 |
UniProt ID | P17275 |
◆ Recombinant Proteins | ||
JUNB-2157R | Recombinant Rhesus Macaque JUNB Protein, His (Fc)-Avi-tagged | +Inquiry |
JUNB-2803R | Recombinant Rat JUNB Protein, His (Fc)-Avi-tagged | +Inquiry |
JUNB-4694M | Recombinant Mouse JUNB Protein, His (Fc)-Avi-tagged | +Inquiry |
JUNB-218H | Recombinant Human JUNB, GST-tagged | +Inquiry |
JUNB-2336R | Recombinant Rhesus monkey JUNB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JUNB-886HCL | Recombinant Human JUNB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JUNB Products
Required fields are marked with *
My Review for All JUNB Products
Required fields are marked with *
0
Inquiry Basket