Active Recombinant Full Length Human MSMP Protein, C-Flag-tagged
Cat.No. : | MSMP-383HFL |
Product Overview : | Recombinant Full Length Human MSMP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 11.1 kDa |
AA Sequence : | MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | MSMP microseminoprotein, prostate associated [ Homo sapiens (human) ] |
Official Symbol | MSMP |
Synonyms | PSMP |
Gene ID | 692094 |
mRNA Refseq | NM_001044264.3 |
Protein Refseq | NP_001037729.1 |
MIM | 612191 |
UniProt ID | Q1L6U9 |
◆ Recombinant Proteins | ||
MSMP-1442H | Recombinant Human MSMP Protein, His (Fc)-Avi-tagged | +Inquiry |
MSMP-383HFL | Active Recombinant Full Length Human MSMP Protein, C-Flag-tagged | +Inquiry |
MSMP-10144M | Recombinant Mouse MSMP Protein | +Inquiry |
MSMP-1128H | Recombinant Human MSMP | +Inquiry |
Msmp-011M | Recombinant Mouse Msmp Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSMP Products
Required fields are marked with *
My Review for All MSMP Products
Required fields are marked with *
0
Inquiry Basket