Active Recombinant Full Length Human RDH11 Protein, C-Flag-tagged
| Cat.No. : | RDH11-441HFL |
| Product Overview : | Recombinant Full Length Human RDH11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is an NADPH-dependent retinal reductase and a short-chain dehydrogenase/reductase. The encoded protein has no steroid dehydrogenase activity. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | MS digestion standard |
| Molecular Mass : | 35.2 kDa |
| AA Sequence : | MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYL ACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTAD GFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANI LFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILS GNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLSIDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Protein Pathways : | Metabolic pathways, Retinol metabolism |
| Full Length : | Full L. |
| Gene Name | RDH11 retinol dehydrogenase 11 [ Homo sapiens (human) ] |
| Official Symbol | RDH11 |
| Synonyms | MDT1; CGI82; PSDR1; RALR1; SCALD; ARSDR1; HCBP12; RDJCSS; SDR7C1 |
| Gene ID | 51109 |
| mRNA Refseq | NM_016026.4 |
| Protein Refseq | NP_057110.3 |
| MIM | 607849 |
| UniProt ID | Q8TC12 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RDH11 Products
Required fields are marked with *
My Review for All RDH11 Products
Required fields are marked with *
