Active Recombinant Full Length Human TRH Protein, C-Flag-tagged

Species :	Human
Source :	Mammalian Cells
Tag :	Flag
Description :	This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism.
Form :	25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity :	Cell treatment
Molecular Mass :	27.2 kDa
AA Sequence :	MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity :	> 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability :	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage :	Store at -80 centigrade.
Concentration :	>50 ug/mL as determined by microplate BCA method.
Preparation :	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families :	Druggable Genome, Secreted Protein
Full Length :	Full L.

Gene Name	TRH thyrotropin releasing hormone [ Homo sapiens (human) ]
Official Symbol	TRH
Synonyms	TRF; Pro-TRH
Gene ID	7200
mRNA Refseq	NM_007117.5
Protein Refseq	NP_009048.1
MIM	613879
UniProt ID	P20396