Active Recombinant Full Length Human TRH Protein, C-Flag-tagged
Cat.No. : | TRH-368HFL |
Product Overview : | Recombinant Full Length Human TRH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 27.2 kDa |
AA Sequence : | MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | TRH thyrotropin releasing hormone [ Homo sapiens (human) ] |
Official Symbol | TRH |
Synonyms | TRF; Pro-TRH |
Gene ID | 7200 |
mRNA Refseq | NM_007117.5 |
Protein Refseq | NP_009048.1 |
MIM | 613879 |
UniProt ID | P20396 |
◆ Recombinant Proteins | ||
Trh-488M | Recombinant Mouse Trh Protein, His-tagged | +Inquiry |
TRH-489H | Recombinant Human TRH Protein, His&GST-tagged | +Inquiry |
TRH-2021Z | Recombinant Zebrafish TRH | +Inquiry |
TRH-703H | Human Thyrotropin-Releasing Hormone Peptide | +Inquiry |
TRH-2244C | Recombinant Chicken TRH | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRH-801HCL | Recombinant Human TRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRH Products
Required fields are marked with *
My Review for All TRH Products
Required fields are marked with *
0
Inquiry Basket