Active Recombinant Human AREG Protein
Cat.No. : | AREG-02H |
Product Overview : | Recombinant Human AREG Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Amphiregulin (AR) is a member of the epidermal growth factor (EGF) family. AR is an autocrine growth factor and functions to regulate cell proliferation and survival through binding the EGF receptor (EGFR). AR promotes the proliferation of neural stem cells and epithelial cells, including keratinocytes and mammary epithelium. Up-regulated at puberty, AR promotes ductal outgrowth and mammary branching. In the liver, AR functions as a mitogen and prevents hepatocyte apoptosis. In a cancer context, AR protects against human adenocarcinoma apoptosis, promotes tumor cell growth, and functions as an oncogenic factor in the Hippo pathway. AR levels are increased in the brain following stress events, such as inflammation, ischemia, and hypoxia. |
Bio-activity : | 3T3 Cell Proliferation, ED50≤20 ng/mL |
Molecular Mass : | Monomer, 10.1 kDa (with 87 amino acids) |
AA Sequence : | SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMK |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | AREG amphiregulin [ Homo sapiens (human) ] |
Official Symbol | AREG |
Synonyms | AREG; amphiregulin; schwannoma derived growth factor , SDGF; schwannoma-derived growth factor; colorectum cell-derived growth factor; AR; SDGF; AREGB; CRDGF; MGC13647; |
Gene ID | 374 |
mRNA Refseq | NM_001657 |
Protein Refseq | NP_001648 |
MIM | 104640 |
UniProt ID | P15514 |
◆ Recombinant Proteins | ||
Areg-32M | Active Recombinant Mouse Areg protein | +Inquiry |
AREG-195A | Active Recombinant Human AREG Protein | +Inquiry |
AREG-402R | Recombinant Rat AREG Protein, His (Fc)-Avi-tagged | +Inquiry |
Areg-242M | Recombinant Mouse Areg Protein, His-tagged | +Inquiry |
AREG-002H | Active Recombinant Human AREG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AREG-8762HCL | Recombinant Human AREG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AREG Products
Required fields are marked with *
My Review for All AREG Products
Required fields are marked with *
0
Inquiry Basket