Active Recombinant Human B3GNT2 Protein (AA 35-397), N-6×His/GFP tagged
| Cat.No. : | B3GNT2-03H |
| Product Overview : | Recombinant Human B3GNT2 Protein (AA 35-397) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | GFP&His |
| Protein Length : | AA 35-397 |
| Description : | This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two transcript variants encoding the same protein have been found for this gene. |
| Bio-activity : | ≥0.69 with 1mM donor and 5mM acceptor |
| Molecular Mass : | ~85 kDa |
| AA Sequence : | KNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC |
| Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
| Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
| Concentration : | 1 μg/μL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol. |
| Preservative : | 0.05 % NaN3 |
| Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
| Gene Name | B3GNT2 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 [ Homo sapiens (human) ] |
| Official Symbol | B3GNT2 |
| Synonyms | B3GNT2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2; B3GNT1, UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 1; B3GN T1; B3GN T2; B3GNT 2; BETA3GNT; beta3Gn-T1; beta3Gn-T2; beta-1,3-Gn-T1; beta-1,3-Gn-T2; beta-1,3-N-acetylglucosaminyltransferase bGnT-1; beta-1,3-N-acetylglucosaminyltransferase bGnT-2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1; B3GNT; BGNT2; B3GNT1; BGnT-2; B3GN-T2; B3GNT-2; |
| Gene ID | 10678 |
| mRNA Refseq | NM_006577 |
| Protein Refseq | NP_006568 |
| MIM | 605581 |
| UniProt ID | Q9NY97 |
| ◆ Recombinant Proteins | ||
| B3GNT2-3029H | Recombinant Human B3GNT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| B3GNT2-019H | Recombinant Human B3GNT2 protein, GST-tagged | +Inquiry |
| B3GNT2-322R | Recombinant Rhesus Macaque B3GNT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| B3GNT2-930H | Active Recombinant Human B3GNT2 Protein, His-tagged | +Inquiry |
| B3GNT2-8546H | Recombinant Human B3GNT2 protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B3GNT2-1396HCL | Recombinant Human B3GNT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GNT2 Products
Required fields are marked with *
My Review for All B3GNT2 Products
Required fields are marked with *
