Active Recombinant Human B3GNT2 Protein (AA 35-397), N-6×His/GFP tagged

Cat.No. : B3GNT2-03H
Product Overview : Recombinant Human B3GNT2 Protein (AA 35-397) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 35-397
Description : This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two transcript variants encoding the same protein have been found for this gene.
Bio-activity : ≥0.69 with 1mM donor and 5mM acceptor
Molecular Mass : ~85 kDa
AA Sequence : KNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC
Purity : >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 μg/μL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name B3GNT2 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 [ Homo sapiens (human) ]
Official Symbol B3GNT2
Synonyms B3GNT2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2; B3GNT1, UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 1; B3GN T1; B3GN T2; B3GNT 2; BETA3GNT; beta3Gn-T1; beta3Gn-T2; beta-1,3-Gn-T1; beta-1,3-Gn-T2; beta-1,3-N-acetylglucosaminyltransferase bGnT-1; beta-1,3-N-acetylglucosaminyltransferase bGnT-2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1; B3GNT; BGNT2; B3GNT1; BGnT-2; B3GN-T2; B3GNT-2;
Gene ID 10678
mRNA Refseq NM_006577
Protein Refseq NP_006568
MIM 605581
UniProt ID Q9NY97

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B3GNT2 Products

Required fields are marked with *

My Review for All B3GNT2 Products

Required fields are marked with *

0
cart-icon