Active Recombinant Human B3GNT2 Protein (AA 35-397), N-6×His/GFP tagged
Cat.No. : | B3GNT2-03H |
Product Overview : | Recombinant Human B3GNT2 Protein (AA 35-397) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 35-397 |
Description : | This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two transcript variants encoding the same protein have been found for this gene. |
Bio-activity : | ≥0.69 with 1mM donor and 5mM acceptor |
Molecular Mass : | ~85 kDa |
AA Sequence : | KNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC |
Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 μg/μL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | B3GNT2 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | B3GNT2 |
Synonyms | B3GNT2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2; B3GNT1, UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 1; B3GN T1; B3GN T2; B3GNT 2; BETA3GNT; beta3Gn-T1; beta3Gn-T2; beta-1,3-Gn-T1; beta-1,3-Gn-T2; beta-1,3-N-acetylglucosaminyltransferase bGnT-1; beta-1,3-N-acetylglucosaminyltransferase bGnT-2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1; B3GNT; BGNT2; B3GNT1; BGnT-2; B3GN-T2; B3GNT-2; |
Gene ID | 10678 |
mRNA Refseq | NM_006577 |
Protein Refseq | NP_006568 |
MIM | 605581 |
UniProt ID | Q9NY97 |
◆ Recombinant Proteins | ||
B3GNT2-930H | Active Recombinant Human B3GNT2 Protein, His-tagged | +Inquiry |
B3GNT2-1835C | Recombinant Chicken B3GNT2 | +Inquiry |
B3GNT2-1718HF | Recombinant Full Length Human B3GNT2 Protein, GST-tagged | +Inquiry |
B3GNT2-019H | Recombinant Human B3GNT2 protein, GST-tagged | +Inquiry |
B3GNT2-494R | Recombinant Rhesus monkey B3GNT2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GNT2-1396HCL | Recombinant Human B3GNT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GNT2 Products
Required fields are marked with *
My Review for All B3GNT2 Products
Required fields are marked with *
0
Inquiry Basket