Recombinant Human B3GNT2 protein, GST-tagged
Cat.No. : | B3GNT2-019H |
Product Overview : | Human B3GNT2 partial ORF ( NP_006568, 111 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | B3GNT2 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 [ Homo sapiens ] |
Official Symbol | B3GNT2 |
Synonyms | B3GNT2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2; B3GNT1, UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 1; B3GN T1; B3GN T2; B3GNT 2; BETA3GNT; beta3Gn-T1; beta3Gn-T2; beta-1,3-Gn-T1; beta-1,3-Gn-T2; beta-1,3-N-acetylglucosaminyltransferase bGnT-1; beta-1,3-N-acetylglucosaminyltransferase bGnT-2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1; B3GNT; BGNT2; B3GNT1; BGnT-2; B3GN-T2; B3GNT-2; |
Gene ID | 10678 |
mRNA Refseq | NM_006577 |
Protein Refseq | NP_006568 |
MIM | 605581 |
UniProt ID | Q9NY97 |
◆ Recombinant Proteins | ||
B3GNT2-322R | Recombinant Rhesus Macaque B3GNT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
B3GNT2-3029H | Recombinant Human B3GNT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
B3GNT2-10103H | Recombinant Human B3GNT2, His-tagged | +Inquiry |
B3GNT2-2526H | Recombinant Human B3GNT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
B3GNT2-494R | Recombinant Rhesus monkey B3GNT2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GNT2-1396HCL | Recombinant Human B3GNT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B3GNT2 Products
Required fields are marked with *
My Review for All B3GNT2 Products
Required fields are marked with *
0
Inquiry Basket