Recombinant Human B3GNT2 protein, GST-tagged
| Cat.No. : | B3GNT2-019H |
| Product Overview : | Human B3GNT2 partial ORF ( NP_006568, 111 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. [provided by RefSeq] |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | B3GNT2 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 [ Homo sapiens ] |
| Official Symbol | B3GNT2 |
| Synonyms | B3GNT2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2; B3GNT1, UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 1; B3GN T1; B3GN T2; B3GNT 2; BETA3GNT; beta3Gn-T1; beta3Gn-T2; beta-1,3-Gn-T1; beta-1,3-Gn-T2; beta-1,3-N-acetylglucosaminyltransferase bGnT-1; beta-1,3-N-acetylglucosaminyltransferase bGnT-2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1; B3GNT; BGNT2; B3GNT1; BGnT-2; B3GN-T2; B3GNT-2; |
| Gene ID | 10678 |
| mRNA Refseq | NM_006577 |
| Protein Refseq | NP_006568 |
| MIM | 605581 |
| UniProt ID | Q9NY97 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GNT2 Products
Required fields are marked with *
My Review for All B3GNT2 Products
Required fields are marked with *
