Recombinant Human B3GNT2 protein, GST-tagged

Cat.No. : B3GNT2-019H
Product Overview : Human B3GNT2 partial ORF ( NP_006568, 111 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name B3GNT2 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 [ Homo sapiens ]
Official Symbol B3GNT2
Synonyms B3GNT2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2; B3GNT1, UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 1; B3GN T1; B3GN T2; B3GNT 2; BETA3GNT; beta3Gn-T1; beta3Gn-T2; beta-1,3-Gn-T1; beta-1,3-Gn-T2; beta-1,3-N-acetylglucosaminyltransferase bGnT-1; beta-1,3-N-acetylglucosaminyltransferase bGnT-2; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1; B3GNT; BGNT2; B3GNT1; BGnT-2; B3GN-T2; B3GNT-2;
Gene ID 10678
mRNA Refseq NM_006577
Protein Refseq NP_006568
MIM 605581
UniProt ID Q9NY97

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B3GNT2 Products

Required fields are marked with *

My Review for All B3GNT2 Products

Required fields are marked with *

0
cart-icon