Active Recombinant Human CCN2 Protein

• Cat.No.: CCN2-36H
• Product Overview: Recombinant Human CCN2 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Connective tissue growth factor (CTGF) is a mitogen that is secreted by vascular endothelial cells in response to basic fibroblast growth factor (bFGF) or vascular endothelial growth factor (VEGF). CTGF promotes cell growth, migration, adhesion, and survival of endothelial cells. CTGF is also important during osteogenesis, chondrogenesis, and skeletogenesis. CTGF has an insulin-like growth factor binding protein (IGFBP) domain, a thrombospondin type 1 repeat (TSR) domain, and a C-terminal cysteine knot motif.
• Bio-activity: HUVEC Proliferation, ED50≤2,000 ng/mL
• Molecular Mass: Monomer, 11.2 kDa (98 aa)
• AA Sequence: MGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥90%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: CCN2 cellular communication network factor 2 [ Homo sapiens (human) ]
• Official Symbol: CCN2
• Synonyms: CCN2; cellular communication network factor 2; CTGF; NOV2; HCS24; IGFBP8; CCN family member 2; IBP-8; IGF-binding protein 8; IGFBP-8; connective tissue growth factor; hypertrophic chondrocyte-specific protein 24; insulin-like growth factor-binding protein 8
• Gene ID: 1490
• mRNA Refseq: NM_001901
• Protein Refseq: NP_001892
• MIM: www.omim.org/entry/121009
• UniProt ID: P29279