| Species : |
Human |
| Source : |
Mammalian cells |
| Tag : |
His |
| Protein Length : |
1-279 aa |
| Form : |
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Bio-activity : |
Measured by its binding ability in a functional ELISA. Immobilized Human PAX8 at 2 μg/mL can bind Anti-PAX8 recombinant antibody. The EC50 is 0.6290-0.7413 ng/mL. |
| Molecular Mass : |
31.7 kDa |
| AASequence : |
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLT |
| Endotoxin : |
Less than 1.0 EU/ug as determined by LAL method. |
| Purity : |
Greater than 95% as determined by SDS-PAGE. |
| Storage : |
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| protein Refseq-Weblink : |
http://www.ncbi.nlm.nih.gov/protein/NP_003457.1 |
| Unit ID : |
Q06710 |
| Unit ID-Weblink : |
https://www.uniprot.org/uniprot/Q06710 |
