Active Recombinant Human SLAMF1, Fc-tagged, Biotinylated
| Cat.No. : | SLAMF1-678H |
| Product Overview : | The recombinant human SLAMF1-Fc fusion protein is expressed as a 445-amino acid protein consisting of Ala21 - Pro237 region of SLAMF1 (UniProt accession #Q13291) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 21-237 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Co-stimulates IL-4 secretion by T cells in the presence of anti-CD3e antibody |
| Molecular Mass : | Calculated molecular mass (kDa): 49.9; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 |
| AA Sequence : | ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDR YKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKG DHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPSTGTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | SLAMF1 signaling lymphocytic activation molecule family member 1 [ Homo sapiens ] |
| Official Symbol | SLAMF1 |
| Synonyms | SLAMF1; signaling lymphocytic activation molecule family member 1; signaling lymphocytic activation molecule , SLAM; signaling lymphocytic activation molecule; CD150; IPO-3; SLAM; CDw150; |
| Gene ID | 6504 |
| mRNA Refseq | NM_003037 |
| Protein Refseq | NP_003028 |
| MIM | 603492 |
| UniProt ID | Q13291 |
| Chromosome Location | 1q23.3 |
| Pathway | Measles, organism-specific biosystem; Measles, conserved biosystem; |
| Function | antigen binding; receptor activity; transmembrane signaling receptor activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF1 Products
Required fields are marked with *
My Review for All SLAMF1 Products
Required fields are marked with *
