Recombinant Human VEGF/PIGF Protein, Tag Free

• Cat.No.: VEGFA&PIGF-28H
• Product Overview: Recombinant Human VEGF and PIGF Protein without tag was co-expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 21-149 aa & 27-191 aa
• Form: Sterile 50mM Hepes, pH6.5, 500mM NaCl, 2mM DTT
• Molecular Mass: 33 kDa
• AASequence: PIGF: avppqqwalsagngssevevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplrekmkpercgdavprr VEGFA: apmaegggqnhhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpteesnitmqimrikphqgqhigemsflqhnkcecrpkkdrarqenpcgpcserrkhlfvqdpqtckcsckntdsrckarqlelnertcrcdkprr
• Endotoxin: < 1.0 EU/μg
• Purity: >97% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.128 mg/mL by Bradford

Gene Information

• Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens ]
• Official Symbol: VEGFA
• Synonyms: VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609
• Gene ID: 7422
• mRNA Refseq: NM_001025366
• Protein Refseq: NP_001020537
• MIM: 192240
• UniProt ID: P15692
• Gene Name 2: PIGF phosphatidylinositol glycan anchor biosynthesis, class F [ Homo sapiens ]
• Official Symbol 2: PIGF
• Synonyms 2: PIGF; phosphatidylinositol glycan anchor biosynthesis, class F; phosphatidylinositol glycan, class F; phosphatidylinositol-glycan biosynthesis class F protein; PIG-F; GPI11 homolog; MGC32646; MGC33136
• Gene ID 2: 5281
• mRNA Refseq 2: NM_002643
• Protein Refseq 2: NP_002634
• MIM 2: 600153
• UniProt ID 2: Q07326