Active Recombinant Mouse Gm13306 Protein

• Cat.No.: Gm13306-012M
• Product Overview: Purified recombinant protein of Mouse predicted gene 13306 (Gm13306), transcript variant 2 without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10.
• Bio-activity: Determined by its ability to chemoattract human peripheral blood lymphocytes using a concentration range of 10.0-100.0 ng/ml.
• Molecular Mass: 10.9 kDa
• AA Sequence: LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Gm13306 predicted gene 13306 [ Mus musculus (house mouse) ]
• Official Symbol: Gm13306
• Synonyms: Gm13306; predicted gene 13306; chemokine (C-C motif) ligand 27b
• Gene ID: 100039863
• mRNA Refseq: NM_001164046
• Protein Refseq: NP_001157518
• UniProt ID: Q9Z1X0