Active Recombinant Mouse Gm13306 Protein

Cat.No. : Gm13306-012M
Product Overview : Purified recombinant protein of Mouse predicted gene 13306 (Gm13306), transcript variant 2 without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10.
Bio-activity : Determined by its ability to chemoattract human peripheral blood lymphocytes using a concentration range of 10.0-100.0 ng/ml.
Molecular Mass : 10.9 kDa
AA Sequence : LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Gm13306 predicted gene 13306 [ Mus musculus (house mouse) ]
Official Symbol Gm13306
Synonyms Gm13306; predicted gene 13306; chemokine (C-C motif) ligand 27b
Gene ID 100039863
mRNA Refseq NM_001164046
Protein Refseq NP_001157518
UniProt ID Q9Z1X0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gm13306 Products

Required fields are marked with *

My Review for All Gm13306 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon