| Species : |
Mouse |
| Source : |
E.coli |
| Description : |
Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10. |
| Bio-activity : |
Determined by its ability to chemoattract human peripheral blood lymphocytes using a concentration range of 10.0-100.0 ng/ml. |
| Molecular Mass : |
10.9 kDa |
| AA Sequence : |
LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN |
| Endotoxin : |
Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : |
>95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : |
Store at -80 centigrade. |
| Storage Buffer : |
Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : |
Resuspend the protein in the desired concentration in proper buffer. |