Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Description : |
Interleukin 27 (IL-27) is a member of the IL-12 cytokine family. It is a heterodimeric cytokine that is composed of two distinct genes, Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. IL-27 is expressed by antigen presenting cells and interacts with a specific cell-surface receptor complex known as IL-27 receptor (IL-27R). This receptor consists of two proteins, IL-27ɑ and gp130. IL-27 induces differentiation of the diverse populations of T cells in the immune system and also upregulates IL-10. |
Form : |
Lyophilized |
Bio-activity : |
The activity is determined by the dose-dependent inhibition of IL-17A expression from mouse CD4+ splenocytes stimulated with TGF-beta and IL-6. 50 ng/mL of mouse p28 inhibits greater than 25% of IL-17A expression. |
Molecular Mass : |
23.7 kDa |
AA Sequence : |
MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP |
Endotoxin : |
< 0.1 EU/μg |
Applications : |
Functional Study SDS-PAGE |
Storage : |
Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : |
Lyophilized with Na2PO4, pH 7.5. |