Active Recombinant Mouse Il27 Protein

• Cat.No.: Il27-5204M
• Product Overview: Mouse Il27 (Q8K3I6) recombinant protein expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Description: Interleukin 27 (IL-27) is a member of the IL-12 cytokine family. It is a heterodimeric cytokine that is composed of two distinct genes, Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. IL-27 is expressed by antigen presenting cells and interacts with a specific cell-surface receptor complex known as IL-27 receptor (IL-27R). This receptor consists of two proteins, IL-27ɑ and gp130. IL-27 induces differentiation of the diverse populations of T cells in the immune system and also upregulates IL-10.
• Form: Lyophilized
• Bio-activity: The activity is determined by the dose-dependent inhibition of IL-17A expression from mouse CD4+ splenocytes stimulated with TGF-beta and IL-6. 50 ng/mL of mouse p28 inhibits greater than 25% of IL-17A expression.
• Molecular Mass: 23.7 kDa
• AA Sequence: MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP
• Endotoxin: < 0.1 EU/μg
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized with Na2PO4, pH 7.5.

Gene Information

• Gene Name: Il27 interleukin 27 [ Mus musculus ]
• Official Symbol: Il27
• Synonyms: IL27; interleukin 27; interleukin-27 subunit alpha; IL27-A; IL-27-A; interleukin 30; IL-27 p28 subunit; IL-27 subunit alpha; p28; Il30; IL-27; IL-27p28
• Gene ID: 246779
• mRNA Refseq: NM_145636
• Protein Refseq: NP_663611