Active Recombinant Mouse Il27 Protein

Cat.No. : Il27-5204M
Product Overview : Mouse Il27 (Q8K3I6) recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Description : Interleukin 27 (IL-27) is a member of the IL-12 cytokine family. It is a heterodimeric cytokine that is composed of two distinct genes, Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. IL-27 is expressed by antigen presenting cells and interacts with a specific cell-surface receptor complex known as IL-27 receptor (IL-27R). This receptor consists of two proteins, IL-27ɑ and gp130. IL-27 induces differentiation of the diverse populations of T cells in the immune system and also upregulates IL-10.
Form : Lyophilized
Bio-activity : The activity is determined by the dose-dependent inhibition of IL-17A expression from mouse CD4+ splenocytes stimulated with TGF-beta and IL-6. 50 ng/mL of mouse p28 inhibits greater than 25% of IL-17A expression.
Molecular Mass : 23.7 kDa
AA Sequence : MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP
Endotoxin : < 0.1 EU/μg
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized with Na2PO4, pH 7.5.
Gene Name Il27 interleukin 27 [ Mus musculus ]
Official Symbol Il27
Synonyms IL27; interleukin 27; interleukin-27 subunit alpha; IL27-A; IL-27-A; interleukin 30; IL-27 p28 subunit; IL-27 subunit alpha; p28; Il30; IL-27; IL-27p28;
Gene ID 246779
mRNA Refseq NM_145636
Protein Refseq NP_663611

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il27 Products

Required fields are marked with *

My Review for All Il27 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon