Active Recombinant Mouse Il27 Protein
| Cat.No. : | Il27-5204M |
| Product Overview : | Mouse Il27 (Q8K3I6) recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Description : | Interleukin 27 (IL-27) is a member of the IL-12 cytokine family. It is a heterodimeric cytokine that is composed of two distinct genes, Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. IL-27 is expressed by antigen presenting cells and interacts with a specific cell-surface receptor complex known as IL-27 receptor (IL-27R). This receptor consists of two proteins, IL-27ɑ and gp130. IL-27 induces differentiation of the diverse populations of T cells in the immune system and also upregulates IL-10. |
| Form : | Lyophilized |
| Bio-activity : | The activity is determined by the dose-dependent inhibition of IL-17A expression from mouse CD4+ splenocytes stimulated with TGF-beta and IL-6. 50 ng/mL of mouse p28 inhibits greater than 25% of IL-17A expression. |
| Molecular Mass : | 23.7 kDa |
| AA Sequence : | MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP |
| Endotoxin : | < 0.1 EU/μg |
| Applications : | Functional Study SDS-PAGE |
| Storage : | Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | Lyophilized with Na2PO4, pH 7.5. |
| Gene Name | Il27 interleukin 27 [ Mus musculus ] |
| Official Symbol | Il27 |
| Synonyms | IL27; interleukin 27; interleukin-27 subunit alpha; IL27-A; IL-27-A; interleukin 30; IL-27 p28 subunit; IL-27 subunit alpha; p28; Il30; IL-27; IL-27p28; |
| Gene ID | 246779 |
| mRNA Refseq | NM_145636 |
| Protein Refseq | NP_663611 |
| ◆ Recombinant Proteins | ||
| IL27-0234M | Active Recombinant Mouse IL27 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| IL27-349H | Active Recombinant Human IL27, Fc-tagged | +Inquiry |
| IL27-3777H | Recombinant Human IL27 Protein (Phe29-Pro243, Met1-Lys229), C-His tagged | +Inquiry |
| IL27-1033H | Recombinant Human IL27 Protein, His-tagged | +Inquiry |
| IL27-335H | Recombinant Human IL27 Protein (Met1-Lys229), His-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL27-001HCL | Recombinant Human IL27 cell lysate | +Inquiry |
| IL27-1309MCL | Recombinant Mouse IL27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il27 Products
Required fields are marked with *
My Review for All Il27 Products
Required fields are marked with *
