Recombinant Rhesus Macaque S100 Calcium Binding Protein B
Cat.No. : | S100B-5482R |
Product Overview : | Recombinant Rhesusmacaque S100 calcium binding protein B is a single, non-glycosylatedpolypeptide chain containing 92 amino acids. |
- Specification
- Gene Information
- Related Products
Cat. No. : | S100B-5482R |
Description : | S100B isglial-specific and is expressed primarily by astrocytes. Not all astrocytes expressS100B. It has been shown that S100B is only expressed by a subtype of mature astrocytesthat ensheath blood vessels and by NG2-expressing cells. This protein mayfunction in neurite extension,proliferation of melanoma cells, stimulation ofCa2+ fluxes,inhibition of PKC-mediatedphosphorylation,astrocytosis and axonal proliferation, and inhibition ofmicrotubule assembly. In the developing CNS, it acts as a neurotrophic factorand neuronal survival protein. |
Source : | E. coli |
Species : | Rhesus Macaque |
Form : | Lyophilized from a0.2μm filtered concentrated solution in PBS, pH 7.4. |
Purity : | >97%by SDS-PAGEand HPLC analyses |
Endotoxin Level : | <0.1 ng/μg ofprotein. |
Amino Acid Sequence : | MSELEKAMVALIDVFHQYSG REGDKHKLKK SELKELINNE LSHFLEEIKEQEVVDKVMETLDSDGDGECD FQEFMAFVAM VTTACHEFFE HE |
Molecular Weight : | 10.7 kDa |
Reconstitution : | Centrifuge vialprior to opening.Reconstitute in sterile distilled water or aqueous buffercontaining 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutionsshould be divided into working aliquots and stored at -80°C. Furtherdilutions should be made in appropriate buffered solutions. |
Storage : | The lyophilizedprotein is stable at 2-4°C, but should be kept desiccated at -20°C for long termstorage. After reconstitution, the protein is stable for 1 week at 2-4°C. Forlong term storage, aliquot and freeze at -80°C. Avoid repeated freeze-thawcycles. |
OfficialSymbol : | S100B |
Gene Name : | S100B S100 calcium bindingprotein B [ Macaca mulatta ] |
Synonyms : | S100B;S100 calcium binding protein B |
Gene ID : | 708117 |
mRNA Refseq : | XM_001098016 |
Protein Refseq : | XP_001098016 |
UniProt ID : | F7ANQ9 |
Products Types
◆ Recombinant Protein | ||
S100B-68H | Active Recombinant Human S100B protein(Ser2-Glu92), hFc-tagged | +Inquiry |
S100B-1945H | Recombinant Human S100B Protein, His (Fc)-Avi-tagged | +Inquiry |
S100B-0052H | Recombinant Human S100B Protein | +Inquiry |
S100B-31010TH | Active Recombinant Human S100B protein(Ser2-Glu92), His-tagged | +Inquiry |
S100b-5673M | Recombinant Mouse S100b Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Protein | ||
S100B-1116H | Native Human S100B Protein | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
◆ Lysates | ||
S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket