| Species : |
Rhesus macaque |
| Source : |
E.coli |
| Tag : |
Non |
| Description : |
S100B isglial-specific and is expressed primarily by astrocytes. Not all astrocytes expressS100B. It has been shown that S100B is only expressed by a subtype of mature astrocytesthat ensheath blood vessels and by NG2-expressing cells. This protein mayfunction in neurite extension,proliferation of melanoma cells, stimulation ofCa2+ fluxes,inhibition of PKC-mediatedphosphorylation,astrocytosis and axonal proliferation, and inhibition ofmicrotubule assembly. In the developing CNS, it acts as a neurotrophic factorand neuronal survival protein. |
| Form : |
Lyophilized from a0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Purity : |
>97%by SDS-PAGEand HPLC analyses |
| Endotoxin Level : |
<0.1 ng/μg ofprotein. |
| Amino Acid Sequence : |
MSELEKAMVALIDVFHQYSG REGDKHKLKK SELKELINNE LSHFLEEIKEQEVVDKVMETLDSDGDGECD FQEFMAFVAM VTTACHEFFE HE |
| Molecular Weight : |
10.7 kDa |
| Reconstitution : |
Centrifuge vialprior to opening.Reconstitute in sterile distilled water or aqueous buffercontaining 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutionsshould be divided into working aliquots and stored at -80°C. Furtherdilutions should be made in appropriate buffered solutions. |
| Storage : |
The lyophilizedprotein is stable at 2-4°C, but should be kept desiccated at -20°C for long termstorage. After reconstitution, the protein is stable for 1 week at 2-4°C. Forlong term storage, aliquot and freeze at -80°C. Avoid repeated freeze-thawcycles. |
| OfficialSymbol : |
S100B |
