"S100B" Related Products

Expand
Expand

Recombinant Rhesus Macaque S100 Calcium Binding Protein B

Cat. No.: S100B-5482R
Product Overview: Recombinant Rhesusmacaque S100 calcium binding protein B is a single, non-glycosylatedpolypeptide chain containing 92 amino acids.
Description: S100B isglial-specific and is expressed primarily by astrocytes. Not all astrocytes expressS100B. It has been shown that S100B is only expressed by a subtype of mature astrocytesthat ensheath blood vessels and by NG2-expressing cells. This protein mayfunction in neurite extension,proliferation of melanoma cells, stimulation ofCa2+ fluxes,inhibition of PKC-mediatedphosphorylation,astrocytosis and axonal proliferation, and inhibition ofmicrotubule assembly. In the developing CNS, it acts as a neurotrophic factorand neuronal survival protein.
Source: E. coli
Species: Rhesus Macaque
Form: Lyophilized from a0.2μm filtered concentrated solution in PBS, pH 7.4.
Purity: >97%by SDS-PAGEand HPLC analyses
Endotoxin Level: <0.1 ng/μg ofprotein.
Amino Acid Sequence: MSELEKAMVALIDVFHQYSG REGDKHKLKK SELKELINNE LSHFLEEIKEQEVVDKVMETLDSDGDGECD FQEFMAFVAM VTTACHEFFE HE
Molecular Weight: 10.7 kDa
Reconstitution: Centrifuge vialprior to opening.Reconstitute in sterile distilled water or aqueous buffercontaining 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutionsshould be divided into working aliquots and stored at -80°C. Furtherdilutions should be made in appropriate buffered solutions.
Storage: The lyophilizedprotein is stable at 2-4°C, but should be kept desiccated at -20°C for long termstorage. After reconstitution, the protein is stable for 1 week at 2-4°C. Forlong term storage, aliquot and freeze at -80°C. Avoid repeated freeze-thawcycles.
OfficialSymbol: S100B
Gene Name: S100B S100 calcium bindingprotein B [ Macaca mulatta ]
Synonyms: S100B;S100 calcium binding protein B
Gene ID: 708117
mRNA Refseq: XM_001098016
Protein Refseq: XP_001098016
UniProt ID: F7ANQ9

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.