"ASPA" Related Products

Expand
Expand

Recombinant Human Aspartoacylase, His-tagged

Cat. No.: ASPA-1920H
Product Overview: Recombinant humanASPA protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: ASPA,also known as aspartoacylase, is expressed in liver, lung and kidney tissue,as well as in skeletal muscle and in cerebral white matter. Existing as ahomodimer, Aspartoacylase functions to catalyze the deacetylation ofN-acetylaspartic acid to produce acetate and L-aspartate.
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 20% glycerol 1mM DTT, 0.1M NaCl, 0.1mMPMSF.
Molecular Weight: 38.1 kDa(336aa), confirmed by MALDI-TOF
Purity: > 90%by SDS-PAGE
Concentration: 0.5mg/ml (determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSMTSCHIA EEHIQKVAIF GGTHGNELTG VFLVKHWLEN GAEIQRTGLE VKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLP YEVRRAQEIN HLFGPKDSED SYDIIFDLHN TTSNMGCTLI LEDSRNNFLI QMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGI EVGPQPQGVL RADILDQMRK MIKHALDFIH HFNEGKEFPP CAIEVYKIIE KVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDG KTIPLGGDCT VYPVFVNEAA YYEKKEAFAK TTKLTLNAKS IRCCLH
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Pathways: Alanineand aspartate metabolism; Alanine; Histidine metabolism
Gene Name: ASPA aspartoacylase [ Homosapiens ]
Official Symbol: ASPA
Synonyms: ASPA; aspartoacylas; ASP; ACY2; ACY-2; aminoacylase2; aminoacylase-2; EC 3.5.1.15; spartoacylase (aminoacylase 2, Canavandisease); Canavan disease
Gene ID: 443
mRNA Refseq: NM_000049
Protein Refseq: NP_000040
MIM: 608034
UniProt ID: P45381
Chromosome Location: 17p13.3
Function: aminoacylase activity; aspartoacylaseactivity; hydrolase activity; metal ion binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.