"HMBS" Related Products

Expand

Recombinant Human Hydroxymethylbilane Synthase, His-tagged

Cat. No.: HMBS-1929H
Product Overview: Recombinant humanHMBS protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography techniques.
Description: Porphobilinogendeaminase, also known as HMBS, is a member of the hydroxymethylbilanesynthase superfamily. It is a cytoplasmic enzyme found in the heme synthesispathway. Deficiency of HMBS causes errors in pyrrole metabolism which in turnleads to an inherited autosomal disorder called acute intermittent porphyria(AIP) which is characterized by acute attacks of neurological dysfunctionswith hypertension, tachycardia, peripheral neurologic disturbances, abdominalpain and excessive amounts of aminolevulinic acid and porphobilinogen in theurine.
Form: Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl.
Molecular Weight: 41.9kDa (385aa)confirmed by MALDI-TOF.
Purity: >95%by SDS-PAGE
Concentration: 1 mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMSGNGN AAATAEENSP KMRVIRVGTR KSQLARIQTD SVVATLKASYPGLQFEIIAM STTGDKILDT ALSKIGEKSL FTKELEHALE KNEVDLVVHSLKDLPTVLPP GFTIGAICKR ENPHDAVVFH PKFVGKTLET LPEKSVVGTS SLRRAAQLQR KFPHLEFRSIRGNLNTRLRK LDEQQEFSAI ILATAGLQRM GWHNRVGQIL HPEECMYAVG QGALGVEVRA KDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVA VHTAMKDGQL YLTGGVWSLD GSDSIQETMQ ATIHVPAQHE DGPEDDPQLV GITARNIPRGPQLAAQNLGI SLANLLLSKG AKNILDVARQ LNDAH
Storage: Can be storedat +4°C short term (1-2 weeks). For long term storage, aliquot and store at-20°C or -70°C. Avoid repeated freezing and thawing cycles.
Pathways: Heme Biosynthesis; Metabolic pathways;Metabolism; Metabolism of porphyrins; Porphyrin and chlorophyll metabolism
Gene Name: HMBS hydroxymethylbilane synthase[ Homo sapiens ]
Official Symbol: HMBS
Synonyms: HMBS; hydroxymethylbilane synthase; UPS;PBGD; PORC; PBG-D; porphobilinogen deaminase; uroporphyrinogen I synthase;pre-uroporphyrinogen synthase; uroporphyrinogen I synthetase; porphyria,acute; Chester type; EC 2.5.1.61
Gene ID: 3145
mRNA Refseq: NM_000190
Protein Refseq: NP_000181
MIM: 609806
UniProt ID: P08397
Chromosome Location: 11q23.3
Function: hydroxymethylbilane synthase activity;transferase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.