"SUOX" Related Products

Expand
Expand

Recombinant Human Sulfite oxidase Mo Centre Domain

Cat. No.: SUOX-191H
Product Overview: Sulfite oxidase comprises the recombinant molybdenumC-terminal domain of Homo sapiens, purified from a TP1000 Escherichia colistrain.
Description: Sulfite oxidase (EC 1.8.3.1) is a homodimeric proteinlocalized in the intermembrane space of mitochondria of all eukaryoticorganisms. Each subunit contains an N-terminal domain, with a heme cofactor,and a C-terminal domain, with a molybdopterin cofactor (MoVI). The enzymecatalyzes the oxidation of sulfite to sulfate, which takes place at themolybdenum centre, and is the final reaction in the oxidative degradation ofthe sulfur amino acids cystein and methionine.
Source: E. coli
Sequence: MGSSHHHHHHSSGLVPRGSHMVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP
Unit definition: One unit of sulfiteoxidase activity is defined as the amount of enzyme required to oxidize 1.0µmol of sulfite to sulfate, per min, in a coupled assay where the hydrogenperoxide formed in the first reaction is reduced by an NADH-peroxidase in thepresence of NADH, at 25 °C and pH 8.5.
Purity: >95%, asdetermined by SDS-PAGE
Specific activity: 0.5 U/mg
Temperature and pHoptimum: The optimum pH andtemperature are 8.5 and 25 °C, respectively.
Storage: Sulfite oxidase should be stored at 4 °C and will remain stableup to 3 years if stored as specified.
Gene Name: SUOXsulfite oxidase [Homo sapiens]
Official Symbol: SUOX
Synonyms: sulfite oxidase; EC1.8.3.1; sulfite oxidase, mitochondrial; OTTHUMP00000158619
Gene ID: 6821
mRNA Refseq: NM_000456
Protein Refseq: NP_000447
MIM: 606887
UniProt ID: P51687
Chromosome Location: 12q13.2
Pathway: Sulfur metabolism, organism-specific biosystem;Sulfur metabolism, conserved biosystem; sulfite oxidation IV, conservedbiosystem; superpathway of methionine degradation, conserved biosystem
Function: binding; electron carrier activity; hemebinding; metal ion binding; molybdenum ion binding; molybdopterin cofactorbinding; oxidoreductase activity; sulfite oxidase activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.