"DEFA1" Related Products

Expand
Expand

Recombinant Human DEFA1, GST-tagged

Cat. No.: DEFA1-2155H
Product Overview: RecombinantHuman protein DEFA1 with GST-tag at N-terminal was produced in wheat germ expressionsystem in vitro and purified by GlutathioneSepharose 4 Fast Flow, 36.08 KDa.
Description: Defensins are a family of microbicidal and cytotoxic peptidesthought to be involved in host defense. They are abundant in the granules ofneutrophils and also found in the epithelia of mucosal surfaces such as thoseof the intestine, respiratory tract, urinary tract, and vagina. Members of thedefensin family are highly similar in protein sequence and distinguished by aconserved cysteine motif. The protein encoded by this gene, defensin, alpha1, is found in the microbicidal granules of neutrophils and likely plays arole in phagocyte-mediated host defense. Several alpha defensin genes areclustered on chromosome 8. This gene differs from defensin, alpha 3 by onlyone amino acid. This gene and the gene encoding defensin, alpha 3 are bothsubject to copy number variation.
Source: Wheat germ
Species: Human
AminoAcid Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Note: Best usewithin three months from the date of receipt of this protein.
Applications: ELISA;WB; Antibody Production; Protein Array
Storage Buffer: 50 mMTris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Storage: Storeat -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name: DEFA1 defensin, alpha 1 [ Homo sapiens ]
Official Symbol: DEFA1
Synonyms: DEFA1;defensin, alpha 1; HP1; MRS; DEF1; HP-1; DEFA2; HNP-1; DEFA1B; MGC138393; neutrophildefensin 1; defensin, alpha 2; myeloid-related sequence; defensin, alpha 1,myeloid-related sequence; OTTHUMP00000196017
Gene ID: 1667
mRNA Refseq: NM_004084
Protein Refseq: NP_004075
MIM: 125220
UniProt ID: P59665
Chromosome Location: 8p23.1
Pathway: Alpha-defensins;Cellular roles of Anthrax toxin; Defensins; Immune System; Innate ImmuneSystem

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.