Recombinant Human ELF5, GST-tagged

Cat.No. : ELF5-904H
Product Overview : Recombinant Human ELF5 (166 a.a. - 263 a.a ) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Molecular Mass : 36.52 kDa
Sequence : SRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED
Purification : Glutathione Sepharose 4 Fast Flow
Storage buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note : Best use within three months from the date of receipt of this protein.
OfficialSymbol : ELF5
Gene Name ELF5 E74-like factor 5 (ets domain transcription factor) [ Homo sapiens ]
Synonyms ELF5; ESE2; E74-like factor 5 (ets domain transcription factor); ETS-related transcription factor Elf-5; epithelium-restricted ESE-1-related Ets factor; epithelium-specific Ets transcription factor 2; Epithelium-restricted ESE-1-related Ets factor; Epithelium-specific Ets transcription factor 2; ESE-2; E74-like factor 5
Gene ID 2001
mRNA Refseq NM_198381
Protein Refseq NP_938195
MIM 605169
UniProt ID Q9UKW6
Chromosome Location 11p13-p12
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELF5 Products

Required fields are marked with *

My Review for All ELF5 Products

Required fields are marked with *

0
cart-icon
0
compare icon