Recombinant Human ELF5 protein, GST-tagged
Cat.No. : | ELF5-3705H |
Product Overview : | Recombinant Human ELF5 protein(1-163 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-163 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESKATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ELF5 E74-like factor 5 (ets domain transcription factor) [ Homo sapiens ] |
Official Symbol | ELF5 |
Synonyms | ELF5; E74-like factor 5 (ets domain transcription factor); ETS-related transcription factor Elf-5; epithelium-restricted ESE-1-related Ets factor; epithelium-specific Ets transcription factor 2; ESE2; |
Gene ID | 2001 |
mRNA Refseq | NM_001243080 |
Protein Refseq | NP_001230009 |
MIM | 605169 |
UniProt ID | Q9UKW6 |
◆ Recombinant Proteins | ||
ELF5-1439R | Recombinant Rhesus monkey ELF5 Protein, His-tagged | +Inquiry |
ELF5-1263R | Recombinant Rhesus Macaque ELF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELF5-12402H | Recombinant Human ELF5 protein, His-tagged | +Inquiry |
ELF5-902H | Recombinant Human ELF5, GST-tagged | +Inquiry |
ELF5-28286TH | Recombinant Human ELF5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELF5-6630HCL | Recombinant Human ELF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELF5 Products
Required fields are marked with *
My Review for All ELF5 Products
Required fields are marked with *
0
Inquiry Basket