"PLGRKT" Related Products

Expand

Rabbit Anti-PLGRKT Polyclonal Antibody

Cat.No. : DPAB8782
Product Overview : Rabbit Anti-PLGRKT Polyclonal Antibody
Target : PLGRKT
Immunogen : Recombinant protein corresponding to amino acids of human C9orf46.
Host : Rabbit
Isotype : IgG
Source : Rabbit
species : Human
Purification : Antigen affinity purification
Conjugation : N/A
Applications : WB,IHC-P
Sequence similarities : KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
Usage recommendation : Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.
Storage : Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Size : 100 uL
Gene Name : PLGRKT plasminogen receptor,C-terminal lysine transmembrane protein [ Homo sapiens ]
Official Symbol : PLGRKT
Synonyms : AD025;MDS030;C9orf46;PLG-RKT;Plg-R(KT)
Gene ID : 55848
mRNA Refseq : NM_018465.3
Protein Refseq : NP_060935.2
UniProt ID : Q9HBL7
Chromosome Location : 9p24.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.