Rabbit Anti-PLGRKT Polyclonal Antibody
Cat.No. : | DPAB8782 |
Product Overview : | Rabbit Anti-PLGRKT Polyclonal Antibody |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Rabbit |
Tag : | Non |
Target : | PLGRKT |
Immunogen : | Recombinant protein corresponding to amino acids of human C9orf46. |
Isotype : | IgG |
species : | Human |
Purification : | Antigen affinity purification |
Conjugation : | N/A |
Applications : | WB,IHC-P |
Sequence similarities : | KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK |
Usage recommendation : | Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user. |
Storage : | Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing. |
Size : | 100 uL |
Gene Name | PLGRKT plasminogen receptor,C-terminal lysine transmembrane protein [ Homo sapiens ] |
Official Symbol | PLGRKT |
Synonyms | AD025;MDS030;C9orf46;PLG-RKT;Plg-R(KT) |
Gene ID | 55848 |
mRNA Refseq | NM_018465.3 |
Protein Refseq | NP_060935.2 |
UniProt ID | Q9HBL7 |
Chromosome Location | 9p24.1 |
◆ Recombinant Proteins | ||
PLGRKT-3384Z | Recombinant Zebrafish PLGRKT | +Inquiry |
PLGRKT-4523R | Recombinant Rat PLGRKT Protein | +Inquiry |
PLGRKT-3473R | Recombinant Rhesus monkey PLGRKT Protein, His-tagged | +Inquiry |
PLGRKT-4183R | Recombinant Rat PLGRKT Protein, His (Fc)-Avi-tagged | +Inquiry |
PLGRKT-3291R | Recombinant Rhesus Macaque PLGRKT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPAB8782 | Rabbit Anti-PLGRKT Polyclonal Antibody | +Inquiry |
PLGRKT-7928HCL | Recombinant Human C9orf46 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLGRKT Products
Required fields are marked with *
My Review for All PLGRKT Products
Required fields are marked with *