"PLGRKT" Related Products

Expand

Rabbit Anti-PLGRKT Polyclonal Antibody

Cat.No.: DPAB8782
Product Overview: Rabbit Anti-PLGRKT Polyclonal Antibody
Target: PLGRKT
Immunogen: Recombinant protein corresponding to amino acids of human C9orf46.
Host: Rabbit
Isotype: IgG
Source: Rabbit
species: Human
Purification: Antigen affinity purification
Conjugation: N/A
Applications: WB,IHC-P
Sequence similarities: KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
Usage recommendation: Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.
Storage: Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Size: 100 uL
Gene Name: PLGRKT plasminogen receptor,C-terminal lysine transmembrane protein [ Homo sapiens ]
Official Symbol: PLGRKT
Synonyms: AD025;MDS030;C9orf46;PLG-RKT;Plg-R(KT)
Gene ID: 55848
mRNA Refseq: NM_018465.3
Protein Refseq: NP_060935.2
UniProt ID: Q9HBL7
Chromosome Location: 9p24.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.