Rabbit Anti-PLGRKT Polyclonal Antibody

• Cat.No.: DPAB8782
• Product Overview: Rabbit Anti-PLGRKT Polyclonal Antibody

Specification

• Species: Human
• Source: Rabbit
• Tag: Non
• Target: PLGRKT
• Immunogen: Recombinant protein corresponding to amino acids of human C9orf46.
• Isotype: IgG
• species: Human
• Purification: Antigen affinity purification
• Conjugation: N/A
• Applications: WB,IHC-P
• Sequence similarities: KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
• Usage recommendation: Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.
• Storage: Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
• Size: 100 uL

Gene Information

• Gene Name: PLGRKT plasminogen receptor,C-terminal lysine transmembrane protein [ Homo sapiens ]
• Official Symbol: PLGRKT
• Synonyms: AD025;MDS030;C9orf46;PLG-RKT;Plg-R(KT)
• Gene ID: 55848
• mRNA Refseq: NM_018465.3
• Protein Refseq: NP_060935.2
• UniProt ID: Q9HBL7
• Chromosome Location: 9p24.1