Rabbit Anti-PLGRKT Polyclonal Antibody
| Cat.No. : | DPAB8782 |
| Product Overview : | Rabbit Anti-PLGRKT Polyclonal Antibody |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Rabbit |
| Tag : | Non |
| Target : | PLGRKT |
| Immunogen : | Recombinant protein corresponding to amino acids of human C9orf46. |
| Isotype : | IgG |
| species : | Human |
| Purification : | Antigen affinity purification |
| Conjugation : | N/A |
| Applications : | WB,IHC-P |
| Sequence similarities : | KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK |
| Usage recommendation : | Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user. |
| Storage : | Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing. |
| Size : | 100 uL |
| Gene Name | PLGRKT plasminogen receptor,C-terminal lysine transmembrane protein [ Homo sapiens ] |
| Official Symbol | PLGRKT |
| Synonyms | AD025;MDS030;C9orf46;PLG-RKT;Plg-R(KT) |
| Gene ID | 55848 |
| mRNA Refseq | NM_018465.3 |
| Protein Refseq | NP_060935.2 |
| UniProt ID | Q9HBL7 |
| Chromosome Location | 9p24.1 |
| ◆ Recombinant Proteins | ||
| PLGRKT-4183R | Recombinant Rat PLGRKT Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL14810MF | Recombinant Full Length Mouse Plasminogen Receptor (Kt) Protein, His-Tagged | +Inquiry |
| RFL16020RF | Recombinant Full Length Rat Plasminogen Receptor (Kt) Protein, His-Tagged | +Inquiry |
| PLGRKT-3384Z | Recombinant Zebrafish PLGRKT | +Inquiry |
| PLGRKT-4523R | Recombinant Rat PLGRKT Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLGRKT-7928HCL | Recombinant Human C9orf46 293 Cell Lysate | +Inquiry |
| DPAB8782 | Rabbit Anti-PLGRKT Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLGRKT Products
Required fields are marked with *
My Review for All PLGRKT Products
Required fields are marked with *



