Rabbit Anti-PLGRKT Polyclonal Antibody

Cat.No. : DPAB8782
Product Overview : Rabbit Anti-PLGRKT Polyclonal Antibody
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Rabbit
Tag : Non
Target : PLGRKT
Immunogen : Recombinant protein corresponding to amino acids of human C9orf46.
Isotype : IgG
species : Human
Purification : Antigen affinity purification
Conjugation : N/A
Applications : WB,IHC-P
Sequence similarities : KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
Usage recommendation : Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.
Storage : Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Size : 100 uL
Gene Name PLGRKT plasminogen receptor,C-terminal lysine transmembrane protein [ Homo sapiens ]
Official Symbol PLGRKT
Synonyms AD025;MDS030;C9orf46;PLG-RKT;Plg-R(KT)
Gene ID 55848
mRNA Refseq NM_018465.3
Protein Refseq NP_060935.2
UniProt ID Q9HBL7
Chromosome Location 9p24.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLGRKT Products

Required fields are marked with *

My Review for All PLGRKT Products

Required fields are marked with *

0
cart-icon