"CHD7" Related Products

Recombinant Human Chromodomain Helicase DNA Binding Protein 7, His-tagged

Cat. No.: CHD7-4914H
Product Overview: Recombinant full length human CHD7 containing N-terminal His tag was expressed by E. coli.
Description: CHD7 is a N-terminal His-tagged recombinant protein and a member of the Sso7d family of small, abundant, non-specific DNA-binding proteins from the hyperthermophilic Archea Sulfolobus. The 7-kDa protein from Sulfolobus spp. consists of a five stranded, incomplete β-barrel capped at the opening by a C-terminal α-helix; they bind to the minor groove of a DNA duplex via the triple-stranded β-sheet.
Molecular Weight: 9.44 kDa
Source: E. coli
Species: Human
Form: Sterile filtered and lyophilized with no additives.
Appearance: Lyophilized protein
Sequence: MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Endotoxin Level: <0.1 ng/μg
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in ddH2O to a concentration of 1.0 mg/ml. Aliquot and store at -20°C for future use. Repeated freeze/thaw cycles should be avoided.
Purity: >99% by SDS-PAGE
Storage: The lyophilized CHD7 is best-stored desiccated below 0°C. Reconstituted protein should be stored in working aliquots at -20°C.
Pathways: Noncanonical Wnt signaling pathway
Gene Name: CHD7 chromodomain helicase DNA binding protein 7 [ Homo sapiens ]
Official Symbol: CHD7
Synonyms: CHD7; chromodomain helicase DNA binding protein 7; IS3; KAL5; FLJ20357; FLJ20361; KIAA1416; chromodomain-helicase-DNA-binding protein 7; OTTHUMP00000229376; ATP-dependent helicase CHD7; chromodomain helicase DNA binding protein 7 isoform CRA_e; EC 3.6.4.12
Gene ID: 55636
mRNA Refseq: NM_017780
Protein Refseq: NP_060250
MIM: 608892
UniProt ID: Q9P2D1
Chromosome Location: 8q12.2
Function: ATP binding; DNA binding; chromatin binding; helicase activity; hydrolase activity, acting on acid anhydrides; nucleotide binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.