Recombinant Rat Il10 protein

Cat.No. : Il10-18R
Product Overview : Recombinant Rat Il10 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 160
Description : Factor involved in the inhibition of cytokine synthesis
Form : Lyophilized from a 0.2μm filtered solution in 20 mM Tris-HCl, pH 8.0, 100 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids.
AA Sequence : SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Endotoxin : Less than 0.1 EU/µg of rRtIL-10 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il10
Official Symbol Il10
Synonyms IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X;
Gene ID 25325
mRNA Refseq NM_012854
Protein Refseq NP_036986
UniProt ID P29456

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il10 Products

Required fields are marked with *

My Review for All Il10 Products

Required fields are marked with *

0
cart-icon
0
compare icon