Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Synthetic Human Brain Natriuretic Peptide 32

Cat.No. : NPPB-8050H
Product Overview : Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis.
Molecular Formula: C143H244N50O42S4
Disulfide bridge: Cys10-Cys26
  • Specification
  • Gene Information
  • Related Products
Source : Human
Species : Human
Molecular Mass : 3464.1
AA Sequence : SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Purity : > 95%
Storage : Store the peptide at -20 centigrade.
Gene Name : NPPB natriuretic peptide B [ Homo sapiens (human) ]
Official Symbol : NPPB
Synonyms : NPPB; natriuretic peptide B; BNP; natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein
Gene ID : 4879
mRNA Refseq : NM_002521
Protein Refseq : NP_002512
MIM : 600295
UniProt ID : P16860

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
In what ways does NPPB protein contribute to the understanding of fluid overload in patients? 04/20/2022

Elevated NPPB levels are associated with fluid overload, providing valuable information for clinicians in managing patients with conditions like edema.

Can NPPB protein be used in monitoring the efficacy of treatments for cardiovascular diseases? 03/02/2020

Yes, monitoring NPPB levels over time can help assess the effectiveness of treatments and interventions in managing cardiovascular conditions.

How do age and gender influence the normal range of NPPB protein levels in healthy individuals? 04/25/2019

Normal ranges of NPPB may vary with age and gender. Understanding these variations is essential for accurate clinical interpretation.

Are there any specific contraindications or limitations in using NPPB protein as a clinical marker? 11/26/2016

While NPPB is a valuable marker, clinicians should consider factors like renal function and comorbidities that may affect its interpretation.

How does NPPB protein influence the management of hypertension in clinical practice? 06/11/2016

NPPB regulates blood pressure by promoting vasodilation and natriuresis. Understanding its levels can guide the management of hypertension.

Customer Reviews (3)

Write a review
Reviews
06/17/2022

    They actively engage with researchers, comprehending their specific experimental needs, and offering tailored services accordingly.

    01/16/2022

      This collaborative partnership facilitates a seamless and efficient research process, as the manufacturer aligns their support and services with my unique requirements.

      12/09/2019

        The manufacturer's excellent technical support, commitment to innovation, and customer-centric approach further reinforce its suitability for my research.

        Ask a Question for All NPPB Products

        Required fields are marked with *

        My Review for All NPPB Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends