Synthetic Human Brain Natriuretic Peptide 32
Cat.No. : | NPPB-8050H |
Product Overview : | Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis. Molecular Formula: C143H244N50O42S4 Disulfide bridge: Cys10-Cys26 |
- Specification
- Gene Information
- Related Products
Source : | Human |
Species : | Human |
Molecular Mass : | 3464.1 |
AA Sequence : | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Purity : | > 95% |
Storage : | Store the peptide at -20 centigrade. |
Gene Name : | NPPB natriuretic peptide B [ Homo sapiens (human) ] |
Official Symbol : | NPPB |
Synonyms : | NPPB; natriuretic peptide B; BNP; natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein |
Gene ID : | 4879 |
mRNA Refseq : | NM_002521 |
Protein Refseq : | NP_002512 |
MIM : | 600295 |
UniProt ID : | P16860 |
Products Types
◆ Recombinant Protein | ||
NPPB-388H | Recombinant Human NPPB Protein, His&SUMO-tagged | +Inquiry |
NPPB-3706R | Recombinant Rat NPPB Protein, His (Fc)-Avi-tagged | +Inquiry |
Nppb-390R | Recombinant Rat Nppb Protein, His&SUMO-tagged | +Inquiry |
Nppb-1852M | Recombinant Mouse Nppb Protein, His&GST-tagged | +Inquiry |
Nppb-389M | Recombinant Mouse Nppb Protein, His&SUMO-tagged | +Inquiry |
◆ Native Protein | ||
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
◆ Lysates | ||
NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionElevated NPPB levels are associated with fluid overload, providing valuable information for clinicians in managing patients with conditions like edema.
Yes, monitoring NPPB levels over time can help assess the effectiveness of treatments and interventions in managing cardiovascular conditions.
Normal ranges of NPPB may vary with age and gender. Understanding these variations is essential for accurate clinical interpretation.
While NPPB is a valuable marker, clinicians should consider factors like renal function and comorbidities that may affect its interpretation.
NPPB regulates blood pressure by promoting vasodilation and natriuresis. Understanding its levels can guide the management of hypertension.
Customer Reviews (3)
Write a reviewThey actively engage with researchers, comprehending their specific experimental needs, and offering tailored services accordingly.
This collaborative partnership facilitates a seamless and efficient research process, as the manufacturer aligns their support and services with my unique requirements.
The manufacturer's excellent technical support, commitment to innovation, and customer-centric approach further reinforce its suitability for my research.
Ask a Question for All NPPB Products
Required fields are marked with *
My Review for All NPPB Products
Required fields are marked with *
Inquiry Basket