"NPPB" Related Products

Expand
Expand
Expand

Synthetic Human Brain Natriuretic Peptide 32

Cat.No. : NPPB-8050H
Product Overview : Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis.
Molecular Formula: C143H244N50O42S4
Disulfide bridge: Cys10-Cys26
Source : Human
Species : Human
Molecular Mass : 3464.1
AA Sequence : SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Purity : > 95%
Storage : Store the peptide at -20 centigrade.
Figure :

Gene Name : NPPB natriuretic peptide B [ Homo sapiens (human) ]
Official Symbol : NPPB
Synonyms : NPPB; natriuretic peptide B; BNP; natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein
Gene ID : 4879
mRNA Refseq : NM_002521
Protein Refseq : NP_002512
MIM : 600295
UniProt ID : P16860

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.