| Cat.No. : | NPPB-8050H |
| Product Overview : | Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis. Molecular Formula: C143H244N50O42S4 Disulfide bridge: Cys10-Cys26 |
| Source : | Human |
| Species : | Human |
| Molecular Mass : | 3464.1 |
| AA Sequence : | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Purity : | > 95% |
| Storage : | Store the peptide at -20 centigrade. |
| Figure : |
|
| Gene Name : | NPPB natriuretic peptide B [ Homo sapiens (human) ] |
| Official Symbol : | NPPB |
| Synonyms : | NPPB; natriuretic peptide B; BNP; natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein |
| Gene ID : | 4879 |
| mRNA Refseq : | NM_002521 |
| Protein Refseq : | NP_002512 |
| MIM : | 600295 |
| UniProt ID : | P16860 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All NPPB Products
Download Datasheet