Recombinant Human NPPB protein, His-tagged
Cat.No. : | NPPB-53H |
Product Overview : | Recombinant Human NPPB fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa. |
Molecular Mass : | 9.0kD |
AA Sequence : | MKKGHHHHHHLVPRGSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLY TLRAPR |
Purity : | Greater than 95% by SDS-PAGE gel analyses. |
Applications : | Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies. |
Storage : | - 20°C for Lyophilized, - 80°C for Liquid |
Gene Name | NPPB natriuretic peptide B [ Homo sapiens ] |
Official Symbol | NPPB |
Synonyms | NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP; |
Gene ID | 4879 |
mRNA Refseq | NM_002521 |
Protein Refseq | NP_002512 |
MIM | 600295 |
UniProt ID | P16860 |
Chromosome Location | 1p36.2 |
Pathway | MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; |
Function | diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding; |
◆ Recombinant Proteins | ||
NPPB-2826H | Recombinant Human NPPB Protein, His-tagged, OVA Conjugated | +Inquiry |
NPPB-13H | Recombinant Human BNP-32 Protein, N-6×His and C-mIgG Fc tagged | +Inquiry |
NPPB-04H | Recombinant Human NT-proBNP Protein, N-6×His and C-mFc tagged | +Inquiry |
NPPB-6042H | Recombinant Human NPPB Protein, GST-tagged | +Inquiry |
NPPB-1298H | Recombinant Human NPPB Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPPB Products
Required fields are marked with *
My Review for All NPPB Products
Required fields are marked with *
0
Inquiry Basket