"NPPB" Related Products

Expand
Expand
Expand

Recombinant Human NPPB protein, His-tagged

Cat.No.: NPPB-53H
Product Overview: Recombinant Human NPPB fused with His tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: His
Form: lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa.
Molecular Mass: 9.0kD
AA Sequence: MKKGHHHHHHLVPRGSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLY TLRAPR
Purity: Greater than 95% by SDS-PAGE gel analyses.
Applications: Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
Storage: - 20°C for Lyophilized, - 80°C for Liquid
Gene Name: NPPB natriuretic peptide B [ Homo sapiens ]
Official Symbol: NPPB
Synonyms: NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP;
Gene ID: 4879
mRNA Refseq: NM_002521
Protein Refseq: NP_002512
MIM: 600295
UniProt ID: P16860
Chromosome Location: 1p36.2
Pathway: MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function: diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.