Recombinant Human NPPB protein, His-tagged

• Cat.No.: NPPB-53H
• Product Overview: Recombinant Human NPPB fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa.
• Molecular Mass: 9.0kD
• AA Sequence: MKKGHHHHHHLVPRGSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLY TLRAPR
• Purity: Greater than 95% by SDS-PAGE gel analyses.
• Applications: Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
• Storage: - 20°C for Lyophilized, - 80°C for Liquid

Gene Information

• Gene Name: NPPB natriuretic peptide B [ Homo sapiens ]
• Official Symbol: NPPB
• Synonyms: NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP
• Gene ID: 4879
• mRNA Refseq: NM_002521
• Protein Refseq: NP_002512
• MIM: 600295
• UniProt ID: P16860
• Chromosome Location: 1p36.2
• Pathway: MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem
• Function: diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding