Recombinant Human NPPB protein, His-tagged NPPB-53H

Recombinant Human NPPB protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human NPPB protein, His-tagged

Recombinant Human NPPB protein, His-tagged

NPPB Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : NPPB-53H
Product Overview : Recombinant Human NPPB fused with His tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : His
Form : lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa.
Molecular Mass : 9.0kD
AA Sequence : MKKGHHHHHHLVPRGSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLY TLRAPR
Purity : Greater than 95% by SDS-PAGE gel analyses.
Applications : Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
Storage : - 20°C for Lyophilized, - 80°C for Liquid
Gene Name : NPPB natriuretic peptide B [ Homo sapiens ]
Official Symbol : NPPB
Synonyms : NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP;
Gene ID : 4879
mRNA Refseq : NM_002521
Protein Refseq : NP_002512
MIM : 600295
UniProt ID : P16860
Chromosome Location : 1p36.2
Pathway : MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function : diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy