Recombinant Human NPPB protein, His-tagged

Cat.No. : NPPB-53H
Product Overview : Recombinant Human NPPB fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Form : lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa.
Molecular Mass : 9.0kD
AA Sequence : MKKGHHHHHHLVPRGSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLY TLRAPR
Purity : Greater than 95% by SDS-PAGE gel analyses.
Applications : Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
Storage : - 20°C for Lyophilized, - 80°C for Liquid
Gene Name NPPB natriuretic peptide B [ Homo sapiens ]
Official Symbol NPPB
Synonyms NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP;
Gene ID 4879
mRNA Refseq NM_002521
Protein Refseq NP_002512
MIM 600295
UniProt ID P16860
Chromosome Location 1p36.2
Pathway MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPPB Products

Required fields are marked with *

My Review for All NPPB Products

Required fields are marked with *

0
cart-icon
0
compare icon