Synthetic Human Brain Natriuretic Peptide 32
Cat.No. : | NPPB-8050H |
Product Overview : | Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis. Molecular Formula: C143H244N50O42S4 Disulfide bridge: Cys10-Cys26 |
- Specification
- Gene Information
- Related Products
Source : | Human |
Species : | Human |
Molecular Mass : | 3464.1 |
AA Sequence : | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Purity : | > 95% |
Storage : | Store the peptide at -20 centigrade. |
Gene Name : | NPPB natriuretic peptide B [ Homo sapiens (human) ] |
Official Symbol : | NPPB |
Synonyms : | NPPB; natriuretic peptide B; BNP; natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein |
Gene ID : | 4879 |
mRNA Refseq : | NM_002521 |
Protein Refseq : | NP_002512 |
MIM : | 600295 |
UniProt ID : | P16860 |
Products Types
◆ Recombinant Protein | ||
Nppb-389M | Recombinant Mouse Nppb Protein, His&SUMO-tagged | +Inquiry |
NPPB-6042H | Recombinant Human NPPB Protein, GST-tagged | +Inquiry |
Nppb-390R | Recombinant Rat Nppb Protein, His&SUMO-tagged | +Inquiry |
NPPB-6170M | Recombinant Mouse NPPB Protein, His (Fc)-Avi-tagged | +Inquiry |
NPPB-2826H | Recombinant Human NPPB Protein, His-tagged, OVA Conjugated | +Inquiry |
◆ Native Protein | ||
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
◆ Lysates | ||
NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket