Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Synthetic Human Brain Natriuretic Peptide 32

Cat.No. : NPPB-8050H
Product Overview : Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis.
Molecular Formula: C143H244N50O42S4
Disulfide bridge: Cys10-Cys26
  • Specification
  • Gene Information
  • Related Products
Source : Human
Species : Human
Molecular Mass : 3464.1
AA Sequence : SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Purity : > 95%
Storage : Store the peptide at -20 centigrade.
Gene Name : NPPB natriuretic peptide B [ Homo sapiens (human) ]
Official Symbol : NPPB
Synonyms : NPPB; natriuretic peptide B; BNP; natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein
Gene ID : 4879
mRNA Refseq : NM_002521
Protein Refseq : NP_002512
MIM : 600295
UniProt ID : P16860

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends