"EPYC" Related Products

Expand
Expand
Expand

Recombinant Human EPYC, His-tagged

Cat.No.: EPYC-9167H
Product Overview: Recombinant human EPYC protein, a DNA sequence encoding human EPYC (Q99645) corresponding to amino acid (1-322) was expressed with a C-terminal polyhistidine tag in HEK293.
Description: Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins.
Source: HEK293
Species: Human
Tag: His
Form: liquid. PBS pH7.4
Molecular Mass: The mature form of human EPYC consists of 303 amino acids (20-322) and has a predicted molecular mass of 37KDa. In SDS-PAGE under reducing conditions, it migrates with an apparent molecular mass of 46KDa due to glycosylation.
Protein length: 1-322a.a.
AA Sequence: MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNRELLTPPPQ PEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPKNTAYFYS RFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDISNNRLGR KGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNVKNLTYIRKALEDIRLDGNP INLSKTPQAYMCLPRLPVGSLV
Purity: >95% as determined by SDS-PAGE
Storage: Store it at +4℃ for short term. For long term storage, store it at -20℃~-70℃
Concentration: 0.4 mg/ml
Gene Name: EPYC epiphycan [ Homo sapiens ]
Official Symbol: EPYC
Synonyms: EPYC; epiphycan; DSPG3; PGLB; Pg-Lb; SLRR3B; dermatan sulfate proteoglycan 3; epiphycan proteoglycan; proteoglycan-lb; small chondroitin/dermatan sulfate proteoglycan; HGNC:3053; Ensembl:ENSG00000083782; HPRD:15988; MIM:601657; Vega:OTTHUMG00000170072
Gene ID: 1833
mRNA Refseq: NM_004950.4
Protein Refseq: NP_004941.2
MIM: 601657
UniProt ID: Q99645
Chromosome Location: 12q21
Function: glycosaminoglycan binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.