"PTPRN" Related Products

Expand
Expand

Recombinant Human PTPRN

Cat.No. : PTPRN-01H
Product Overview : Recombinant Human PTPRN protein, a DNA sequence encoding the amino acid (605-979) was expressed in E. coli and purified by Affinity chromatography, RT-HPLC.
Description : The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants.
Source : E. coli
Species : Human
Form : 1×PBS
Molecular Mass : 42.3kDa
AA Sequence : RQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSW CEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIK LKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPD EGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRG RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILK ALPQ
Endotoxin : <1.0eu g purified protein (lal>
Purity : >99% as determined by RT-HPLC
Storage : Can be stored at +4℃ short term (1-2 weeks). For long term storage, store at -20℃ or -70℃
Gene Name : PTPRN protein tyrosine phosphatase, receptor type, N [ Homo sapiens ]
Official Symbol : PTPRN
Synonyms : PTPRN; protein tyrosine phosphatase, receptor type, N; receptor-type tyrosine-protein phosphatase-like N; IA 2; ICA 512; PTP IA-2; islet cell antigen 2; islet cell antigen 512; islet cell autoantigen 3; protein tyrosine phosphatase-like N; IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; FLJ16131;
Gene ID : 5798
mRNA Refseq : NM_001199763
Protein Refseq : NP_001186692
MIM : 601773
UniProt ID : Q16849
Chromosome Location : 2q35-q36.1
Pathway : Type I diabetes mellitus, organism-specific biosystem; Type I diabetes mellitus, conserved biosystem;
Function : GTPase binding; hydrolase activity; phosphatase activity; protein binding; protein tyrosine phosphatase activity; receptor activity; transmembrane receptor protein tyrosine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.