Recombinant Human ACOT12 protein, His-tagged
Cat.No. : | ACOT12-9297H |
Product Overview : | Recombinant Human ACOT12 protein(206-555 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 206-555 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITFPRIQPISKDDFRRYRGAIARKRIRLGRKYVISHKEEVPLCIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHFVSCEVIDWVSEDDQLYHITCPILNDDKPKDLVVLVSRRKPLKDGNTYTVAVKSVILPSVPPSPQYIRSEIICAGFLIHAIDSNSCIVSYFNHMSASILPYFAGNLGGWSKSIEETAASCIQFLENPPDDGFVSTF |
Gene Name | ACOT12 acyl-CoA thioesterase 12 [ Homo sapiens ] |
Official Symbol | ACOT12 |
Synonyms | ACOT12; acyl-CoA thioesterase 12; acyl-coenzyme A thioesterase 12; Cach; StAR related lipid transfer (START) domain containing 15; STARD15; THEAL; hCACH-1; cytosolic acetyl-CoA hydrolase; acyl-CoA thioester hydrolase 12; START domain-containing protein 15; cytoplasmic acetyl-CoA hydrolase 1; StAR-related lipid transfer (START) domain containing 15; CACH-1; MGC105114; |
Gene ID | 134526 |
mRNA Refseq | NM_130767 |
Protein Refseq | NP_570123 |
MIM | 614315 |
UniProt ID | Q8WYK0 |
◆ Recombinant Proteins | ||
ACOT12-168H | Recombinant Human ACOT12 Protein, GST-Tagged | +Inquiry |
Acot12-1498M | Recombinant Mouse Acot12 Protein, Myc/DDK-tagged | +Inquiry |
ACOT12-457R | Recombinant Rat ACOT12 Protein | +Inquiry |
ACOT12-785HF | Recombinant Full Length Human ACOT12 Protein, GST-tagged | +Inquiry |
ACOT12-3440H | Recombinant Human ACOT12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACOT12-9090HCL | Recombinant Human ACOT12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACOT12 Products
Required fields are marked with *
My Review for All ACOT12 Products
Required fields are marked with *