Recombinant Human ACOT12 protein, His-tagged

• Cat.No.: ACOT12-9297H
• Product Overview: Recombinant Human ACOT12 protein(206-555 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 206-555 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITFPRIQPISKDDFRRYRGAIARKRIRLGRKYVISHKEEVPLCIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHFVSCEVIDWVSEDDQLYHITCPILNDDKPKDLVVLVSRRKPLKDGNTYTVAVKSVILPSVPPSPQYIRSEIICAGFLIHAIDSNSCIVSYFNHMSASILPYFAGNLGGWSKSIEETAASCIQFLENPPDDGFVSTF

Gene Information

• Gene Name: ACOT12 acyl-CoA thioesterase 12 [ Homo sapiens ]
• Official Symbol: ACOT12
• Synonyms: ACOT12; acyl-CoA thioesterase 12; acyl-coenzyme A thioesterase 12; Cach; StAR related lipid transfer (START) domain containing 15; STARD15; THEAL; hCACH-1; cytosolic acetyl-CoA hydrolase; acyl-CoA thioester hydrolase 12; START domain-containing protein 15; cytoplasmic acetyl-CoA hydrolase 1; StAR-related lipid transfer (START) domain containing 15; CACH-1; MGC105114
• Gene ID: 134526
• mRNA Refseq: NM_130767
• Protein Refseq: NP_570123
• MIM: 614315
• UniProt ID: Q8WYK0