Recombinant Human ACOT12 protein, His-tagged

Cat.No. : ACOT12-9297H
Product Overview : Recombinant Human ACOT12 protein(206-555 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability June 18, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 206-555 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MAWMETVATISASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITFPRIQPISKDDFRRYRGAIARKRIRLGRKYVISHKEEVPLCIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHFVSCEVIDWVSEDDQLYHITCPILNDDKPKDLVVLVSRRKPLKDGNTYTVAVKSVILPSVPPSPQYIRSEIICAGFLIHAIDSNSCIVSYFNHMSASILPYFAGNLGGWSKSIEETAASCIQFLENPPDDGFVSTF
Gene Name ACOT12 acyl-CoA thioesterase 12 [ Homo sapiens ]
Official Symbol ACOT12
Synonyms ACOT12; acyl-CoA thioesterase 12; acyl-coenzyme A thioesterase 12; Cach; StAR related lipid transfer (START) domain containing 15; STARD15; THEAL; hCACH-1; cytosolic acetyl-CoA hydrolase; acyl-CoA thioester hydrolase 12; START domain-containing protein 15; cytoplasmic acetyl-CoA hydrolase 1; StAR-related lipid transfer (START) domain containing 15; CACH-1; MGC105114;
Gene ID 134526
mRNA Refseq NM_130767
Protein Refseq NP_570123
MIM 614315
UniProt ID Q8WYK0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACOT12 Products

Required fields are marked with *

My Review for All ACOT12 Products

Required fields are marked with *

0
cart-icon
0
compare icon