Recombinant Human ADH7 protein, His-tagged
Cat.No. : | ADH7-9421H |
Product Overview : | Recombinant Human ADH7 protein(253-349 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 253-349 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | ISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLA |
Gene Name | ADH7 alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide [ Homo sapiens ] |
Official Symbol | ADH7 |
Synonyms | ADH7; alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide; alcohol dehydrogenase class 4 mu/sigma chain; ADH 4; retinol dehydrogenase; alcohol dehydrogenase-7; alcohol dehydrogenase VII; gastric alcohol dehydrogenase; class IV sigma-1 alcohol dehydrogenase; class IV sigmasigma alcohol dehydrogenase; alcohol dehydrogenase class IV mu/sigma chain; ADH4; |
Gene ID | 131 |
mRNA Refseq | NM_000673 |
Protein Refseq | NP_000664 |
MIM | 600086 |
UniProt ID | P40394 |
◆ Recombinant Proteins | ||
ADH7-1318H | Recombinant Human ADH7 Protein (1-386 aa), His-tagged | +Inquiry |
ADH7-9421H | Recombinant Human ADH7 protein, His-tagged | +Inquiry |
Adh7-542M | Recombinant Mouse Adh7 Protein, MYC/DDK-tagged | +Inquiry |
ADH7-1357M | Recombinant Mouse ADH7 Protein | +Inquiry |
ADH7-182R | Recombinant Rat ADH7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADH7-9012HCL | Recombinant Human ADH7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADH7 Products
Required fields are marked with *
My Review for All ADH7 Products
Required fields are marked with *