Recombinant Human ALDH1B1 protein, His-tagged

Cat.No. : ALDH1B1-9553H
Product Overview : Recombinant Human ALDH1B1 protein(330-382 aa), fused with His tag, was expressed in E.coli.
Availability July 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 330-382 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGA
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ALDH1B1 aldehyde dehydrogenase 1 family, member B1 [ Homo sapiens ]
Official Symbol ALDH1B1
Synonyms ALDH1B1; aldehyde dehydrogenase 1 family, member B1; ALDH5; aldehyde dehydrogenase X, mitochondrial; ALDHX; ALDH class 2; aldehyde dehydrogenase 5; acetaldehyde dehydrogenase 5; MGC2230;
Gene ID 219
mRNA Refseq NM_000692
Protein Refseq NP_000683
MIM 100670
UniProt ID P30837

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALDH1B1 Products

Required fields are marked with *

My Review for All ALDH1B1 Products

Required fields are marked with *

0
cart-icon