Recombinant Human ALDH1B1 protein, His-tagged
Cat.No. : | ALDH1B1-9553H |
Product Overview : | Recombinant Human ALDH1B1 protein(330-382 aa), fused with His tag, was expressed in E.coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 330-382 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ALDH1B1 aldehyde dehydrogenase 1 family, member B1 [ Homo sapiens ] |
Official Symbol | ALDH1B1 |
Synonyms | ALDH1B1; aldehyde dehydrogenase 1 family, member B1; ALDH5; aldehyde dehydrogenase X, mitochondrial; ALDHX; ALDH class 2; aldehyde dehydrogenase 5; acetaldehyde dehydrogenase 5; MGC2230; |
Gene ID | 219 |
mRNA Refseq | NM_000692 |
Protein Refseq | NP_000683 |
MIM | 100670 |
UniProt ID | P30837 |
◆ Recombinant Proteins | ||
ALDH1B1-5002H | Recombinant Human ALDH1B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALDH1B1-618R | Recombinant Rat ALDH1B1 Protein | +Inquiry |
ALDH1B1-8938H | Recombinant Human ALDH1B1 Protein, Myc/DDK-tagged | +Inquiry |
ALDH1B1-553H | Recombinant Human ALDH1B1 protein, His-GST&V5-Myc-tagged | +Inquiry |
ALDH1B1-4893M | Recombinant Mouse Aldh1b1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH1B1-16HCL | Recombinant Human ALDH1B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDH1B1 Products
Required fields are marked with *
My Review for All ALDH1B1 Products
Required fields are marked with *