Recombinant Human ALDH1B1 protein, His-tagged

• Cat.No.: ALDH1B1-9553H
• Product Overview: Recombinant Human ALDH1B1 protein(330-382 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 330-382 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ALDH1B1 aldehyde dehydrogenase 1 family, member B1 [ Homo sapiens ]
• Official Symbol: ALDH1B1
• Synonyms: ALDH1B1; aldehyde dehydrogenase 1 family, member B1; ALDH5; aldehyde dehydrogenase X, mitochondrial; ALDHX; ALDH class 2; aldehyde dehydrogenase 5; acetaldehyde dehydrogenase 5; MGC2230
• Gene ID: 219
• mRNA Refseq: NM_000692
• Protein Refseq: NP_000683
• MIM: 100670
• UniProt ID: P30837