Recombinant Human CHIC2 protein, GST-tagged
Cat.No. : | CHIC2-11176H |
Product Overview : | Recombinant Human CHIC2 protein(1-165 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-165 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CHIC2 cysteine-rich hydrophobic domain 2 [ Homo sapiens ] |
Official Symbol | CHIC2 |
Synonyms | CHIC2; cysteine-rich hydrophobic domain 2; cysteine-rich hydrophobic domain 2 protein; BTL; BRX-like translocated in leukemia; cystein-rich hydrophobic domain 2; MGC21173; |
Gene ID | 26511 |
mRNA Refseq | NM_012110 |
Protein Refseq | NP_036242 |
MIM | 604332 |
UniProt ID | Q9UKJ5 |
◆ Recombinant Proteins | ||
CHIC2-3396M | Recombinant Mouse CHIC2 Protein | +Inquiry |
CHIC2-3198HF | Recombinant Full Length Human CHIC2 Protein, GST-tagged | +Inquiry |
CHIC2-1642M | Recombinant Mouse CHIC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHIC2-11342Z | Recombinant Zebrafish CHIC2 | +Inquiry |
CHIC2-5177H | Recombinant Human CHIC2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHIC2-7537HCL | Recombinant Human CHIC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHIC2 Products
Required fields are marked with *
My Review for All CHIC2 Products
Required fields are marked with *